<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20361
| Description |
Thioredoxin-like protein YLS8 |
| Sequence | MSYLLPHLHSGWQVDQAILAEEERVVIIRFGNDGNATCMQMDEVLASVANTLKNFAVIYLVDIDEVPDFKIMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWPIKDKQEFIDIVETVYRGARKGRGLLVENLGEAIENGTRDQHFDSLVTELSSKFEKCQQLLNNISASISSKAACYMPSRIWLSRIETVEGTKQKVAEAEQMLNQRRELVAKYKNSLEELTKSDI |
| Length | 228 |
| Position | Middle |
| Organism | Artemisia annua (Sweet wormwood) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae> Anthemideae>
Artemisiinae> Artemisia.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.289 |
| Instability index | 38.45 |
| Isoelectric point | 5.24 |
| Molecular weight | 26087.52 |
| Publications | PubMed=29703587
|
Function
| Annotated function |
|
| GO - Cellular Component | U4/U6 x U5 tri-snRNP complex GO:0046540 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | mRNA splicing, via spliceosome GO:0000398 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20361
No repeats found
No repeats found
|