Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MDSAAPNPSATAAAAVAAGNGVQASEAGGERSEDASKQNLAQVTSSIQKTLGLLHQLNLTVSSFNSASQLPLLQRLNALVAELDTMQKLAEGCDIQVPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEELEQAFPEDVEQYREIRASSAAEAKRLAQSQSTLPNGDVKVKAEH |
Length | 190 |
Position | Middle |
Organism | Panicum hallii var. hallii |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Panicodae> Paniceae> Panicinae> Panicum> Panicum sect. Panicum. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.403 |
Instability index | 36.48 |
Isoelectric point | 5.02 |
Molecular weight | 20340.52 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP20328 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 49.68| 15| 17| 51| 65| 1 --------------------------------------------------------------------------- 51- 65 (25.44/16.66) LGLLHQLNLTVSSFN 70- 84 (24.25/15.60) LPLLQRLNALVAELD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MDSAAPNPSATAAAAVAAGNGV 2) PEDVEQYREIRA | 1 152 | 22 163 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab