<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20320

Description Uncharacterized protein
SequenceMGTGAQKWQAGPRQAKQPPAGRRGQPRQQAKRTRRSSCSLQRTGMATAATAGSSSPPTPHADDSPEPPLPGEKVYVAVGREVAESRATLLWALHKFPRGAGAGAASFVLLHVYSPPKLLPFLGARIPAAQVGEQELAAHKEMELQRVNDSLDQYLHLCAQGKIHAEKLVVESDDVAQGLVELISEHNVTALVMGAASDKHYTKKMKIPKSRKARFVELQADPSCKIWFICKGTLVCHRKAVQLSHEEMQECRQSSGVTHYSVDKSASLSEMWCVANTWLCKSIGEQRIERTTSDPFYISEKDNVEETCESYNNFQHILRELESVRQEAYEEKCRREKAERELFEALQKAQASENLYLREMKQKNELEEKLTTIMEEIESLTVRTDELCAKLQGEREQRMVLEKRGAHSDRIIKDLMLQRDKALRETEMLRAKKGESSATAEGMMHITELAYSEIKEATNDFDHSMKIGESVYGSVYKGFLRHTNVAIKKLNPETTQTQSQFSQEVEILSRVRHPNLVTLIGACKDAQALVYEYMPNGSLDDRLACKDNSKPLSWQLRTRIASNICSALIFLHSNKPHSIVHSDLKASNILLDGNNVAKLSGFGVSQILTDQFKATTTLYRYTHPKGSFVYIDPEYLISGDLTPQSDVYSFGIVLLRLLTGRSGFGLLKEVQEAMEKGCLQAILDSSAGEWPAMYAEQLAELGLRCCKIRRKNRPDLQTEAWTVLEPMFKSVSTMLCSLSFKSVSEDLGGVPSYFICPILQDVMRDPLIAADGFTYEADAIREWLDSGHQTSPMTNLELPHRDLLPNHALRSAIQEWLQTNGD
Length822
PositionTail
OrganismPanicum hallii var. hallii
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Panicodae> Paniceae> Panicinae> Panicum> Panicum sect. Panicum.
Aromaticity0.06
Grand average of hydropathy-0.448
Instability index47.26
Isoelectric point6.59
Molecular weight92162.99
Publications









Function






Annotated function

Functions as an E3 ubiquitin ligase.



ECO:0000256	ARBA:ARBA00003861

GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats
>MDP20320
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.02|      20|      20|     571|     590|       1
---------------------------------------------------------------------------
  550-  574 (28.34/17.99)	KPLSWqlrtrIASNICSALIFLHSN
  575-  594 (33.68/22.73)	KPHSI.....VHSDLKASNILLDGN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      80.77|      20|      22|     315|     336|       3
---------------------------------------------------------------------------
  317-  336 (32.63/17.81)	ILRELESVRQEAYEEKCRRE
  342-  359 (25.14/ 9.51)	LFEALQ..KAQASENLYLRE
  373-  390 (23.00/11.05)	IMEEIESLTVRT.DELCAK.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.53|      17|      22|     230|     251|       4
---------------------------------------------------------------------------
  232-  251 (23.45/26.16)	GTLVCHR...KAVQLSheEMQeC
  254-  273 (28.08/11.09)	SSGVTHYsvdKSASLS..EMW.C
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.35|      20|      20|     435|     454|       6
---------------------------------------------------------------------------
  435-  454 (33.00/21.12)	ESSATAEGMMHITELAYSEI
  456-  475 (34.35/22.26)	EATNDFDHSMKIGESVYGSV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.51|      11|      26|     395|     405|      10
---------------------------------------------------------------------------
  395-  405 (19.49/11.37)	REQRMVLEKRG
  424-  434 (19.02/10.93)	RETEMLRAKKG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP20320 with Med32 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MGTGAQKWQAGPRQAKQPPAGRRGQPRQQAKRTRRSSCSLQRTGMATAATAGSSSPPTPHADDSPEPPLPGEKVYVA
1
77










Molecular Recognition Features






MoRF SequenceStartStop




1) MGTGAQKWQAGPRQAKQPPAGRRGQP
1
26