<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20318
| Description |
Uncharacterized protein |
| Sequence | MDSDEKKFGKGPRELTGAVDLISHYKLLPHHDFFCKKPLPLAISDTHYLHNVVGDTEIRKGEGMELDQLVQNAYMRNKPASIQPFDMEILGQAFQLRETAPVDLPSAEKGIPTISGKPKSESKDKEKKHKKHKDKDRDKDKEHKKHKHRHKDRSKDKDKDKDKDKKKDKSGHHDSGGDHSKKHHDKKRKHEGMEDSADVHKHKKSKHKSSKTDEMGNGLS |
| Length | 220 |
| Position | Head |
| Organism | Panicum hallii var. hallii |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Panicinae> Panicum>
Panicum sect. Panicum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.572 |
| Instability index | 35.28 |
| Isoelectric point | 9.43 |
| Molecular weight | 25246.18 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20318
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.33| 18| 21| 133| 152| 1
---------------------------------------------------------------------------
149- 170 (25.20/ 6.79) RHKDrskdKDKDKDKDKKKDKS
171- 188 (30.13/ 6.88) GHHD....SGGDHSKKHHDKKR
---------------------------------------------------------------------------
|