<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20301
| Description |
Uncharacterized protein |
| Sequence | MEATVDDLSAAYDEFVAAAAAVMEARAQSGGEKTAATDAALEAFKQRWELFRVACDHAEELVESIRQRIGSECLVDEATGSASSGSGPAPLAAAPGIKPISAVRLEQMSKAVRWLVIELQHGAGGASAPGAAGSGGAATPNAGAGPGPGGQHPEEGGQ |
| Length | 158 |
| Position | Tail |
| Organism | Panicum hallii var. hallii |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Panicinae> Panicum>
Panicum sect. Panicum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.142 |
| Instability index | 50.53 |
| Isoelectric point | 4.64 |
| Molecular weight | 15766.25 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20301
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.00| 15| 15| 14| 28| 1
---------------------------------------------------------------------------
14- 28 (24.46/17.46) EFVAAAAAVMEARAQ
32- 46 (24.54/17.53) EKTAATDAALEAFKQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.77| 16| 57| 78| 95| 2
---------------------------------------------------------------------------
78- 95 (25.30/13.76) ATGSAssGSGPAPLAAAP
138- 153 (33.46/13.78) ATPNA..GAGPGPGGQHP
---------------------------------------------------------------------------
|