<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20290
| Description |
Uncharacterized protein |
| Sequence | MSATPLPPPGQPPPPPGTDGAGGLPPPPGTDMTGICFRDQLWLNSYPLDRNLVFDYFALSPFYDITCNNEALRSRQIHPLDMSQLTKMTGMEYVLSEVMEPHLFVIRKQKRESPEKSSPMLAYYILDGSIYQAPQLCNVFASRISRAMHHISKAFTVACSKLEKIGNVETDSDAAASESKTQKEAIDLKELKRIDHILSSLKRKIGAAPPPPPYPEGYAPPSAEQEKAPDDVLASEAPPQLDPIIDQGPAKRPRFQ |
| Length | 256 |
| Position | Head |
| Organism | Panicum hallii var. hallii |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Panicinae> Panicum>
Panicum sect. Panicum.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.485 |
| Instability index | 73.53 |
| Isoelectric point | 5.77 |
| Molecular weight | 28221.94 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20290
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 83.82| 15| 195| 12| 26| 1
---------------------------------------------------------------------------
12- 26 (32.91/13.09) PPPPPGTDGAGGLPP
211- 221 (26.23/ 9.17) PPPYP..EGYA..PP
225- 239 (24.68/ 8.26) QEKAPDDVLASEAPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.24| 20| 30| 28| 49| 2
---------------------------------------------------------------------------
28- 49 (36.36/31.94) PGTDMTgiCFRDQLWLNS.YPLD
61- 81 (34.88/23.24) PFYDIT..CNNEALRSRQiHPLD
---------------------------------------------------------------------------
|