<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20265
Description |
Uncharacterized protein |
Sequence | MASEAARRRQELAAEGQRHLEETIAAAFQILVSMNDELCNAGLWSSISVSAAAAAAAAAGPQHQHSATPPPPHSADSDAADAGGAPGPGGSLDEARHRYKSAVTALRTSIAAVSSCAQDIGSTESEADHAEIERLEEHASALRKEIESKNKHIKLLMDQLRELVADISMWQSPCSV |
Length | 176 |
Position | Head |
Organism | Panicum hallii var. hallii |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Panicinae> Panicum>
Panicum sect. Panicum.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.340 |
Instability index | 60.41 |
Isoelectric point | 5.19 |
Molecular weight | 18500.29 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP20265
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.44| 12| 26| 50| 61| 1
---------------------------------------------------------------------------
50- 61 (20.63/10.41) SAAAAAAAAAGP
77- 88 (23.81/13.18) SDAADAGGAPGP
---------------------------------------------------------------------------
|