<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20243

Description Uncharacterized protein
SequenceMATQEEAVVPESSLSSDPPITIGLAVSSSKSSKYAVKWALKNFSARERTRFMLIHVRQKVTLVPTPMGNYVPVDQVRDDIASAYEKEVECEAQNMLLMYKNMCNGKVEAEILVVKGDDVAETISGVVSACQIHKLVVGVSSQGNFMRKSKGTRTSSRICKSVPSFCMVYAVSKSGLSMVYSPGSEGNNSYEIFQVNESSNSELYSDDKSSVSDITPSRISGSNLPGGNLDSSSSAEHNRPRSLQEYLTGSTLAAIVDKDQSGSPRGADQITESSNLRISEKSPTVSRALQELMRSEDKASTLCAGHISAPTNLPVSAKAASVKSALQELMLSEDKDNVNFEREKLKIKLGHMRGVCKLVEDESTSASQQMIDLIEKRAQEEARLVEVHSRINTAIEAARKEREQRYAAEVQARHVRDLANEEALKKQHVQLTASREADDMQKLEKLLELGGKPYILFTWEEMESATSSFSEALKIGSGANGTVYKGKIHQTTVAIKLLKSDDSRVTKHFKQELEVLSKTRHRHLLLLLGACLDRACLVYEYMENGSLEDRLQCKGGTSPLPWYYRFRIAWEIALALIYLHSSRPKPIIHRDLKPANILLDSNFTSKIGDAGIATLLPLSEASSTHTIRKHTDLVGTLFYMDPEYQRSGQVSAKSDVYALGMVFLQLLTAKSPMGLADTVERAVEERRLVDILDQRAGKWPVKAAYELAQLGLSCLEMRGKNRPDLKSNVLVVLERLNKIASTARDSVRPVPTGPPSHFICPILKRVMQDPCIASDGYSYERVAIEMWLHENDVSPLTKTQLPDKNLVPNHALLCAINSWKGEAGTGGITG
Length830
PositionTail
OrganismPanicum hallii var. hallii
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Panicodae> Paniceae> Panicinae> Panicum> Panicum sect. Panicum.
Aromaticity0.05
Grand average of hydropathy-0.334
Instability index41.20
Isoelectric point7.83
Molecular weight91580.46
Publications









Function






Annotated function

Functions as an E3 ubiquitin ligase.



GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP20243
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     126.32|      36|      36|     263|     298|       1
---------------------------------------------------------------------------
  263-  298 (63.38/42.79)	SPRGADQITESSNLRISEKSPTVSRALQELMRSEDK
  300-  335 (62.94/42.43)	STLCAGHISAPTNLPVSAKAASVKSALQELMLSEDK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.04|      21|     293|     366|     387|       2
---------------------------------------------------------------------------
  366-  387 (31.40/22.85)	ASQQM..IDLIEkRAQEEARLVEV
  669-  691 (31.64/18.35)	AKSPMglADTVE.RAVEERRLVDI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.29|      21|     293|      42|      63|       3
---------------------------------------------------------------------------
   42-   63 (32.47/29.99)	NFsARERTRFMLIHVRQKVTLV
  339-  359 (37.83/29.34)	NF.EREKLKIKLGHMRGVCKLV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.96|      16|      38|     115|     130|       5
---------------------------------------------------------------------------
  115-  130 (27.43/13.58)	KGDDVAETI.SGVVSAC
  150-  166 (24.53/11.54)	KGTRTSSRIcKSVPSFC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.92|      23|     686|      64|      86|       8
---------------------------------------------------------------------------
   64-   86 (44.66/28.95)	PT.PMGNYV.PV.DQVRDD..IAS...AYEK
  751-  781 (22.26/11.03)	PTgPPSHFIcPIlKRVMQDpcIASdgySYER
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP20243 with Med32 domain of Kingdom Viridiplantae
Unable to open file!