<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20242
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MSHTGSAPADKETDPGVQRFQLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLKYWQRPEYIKYIIYPHCLFFLELLQNANFRNAMAHPANKELAHRQQYFFWKNYRNNRLKHILPRPPPEPAPAPAPSQGPATVPLPPSVSTPVAPPVPAPSSSMPPVAAGGASAMSPMQFVGTPGTNMPKTDMRNAMGNRKRKMG |
| Length | 201 |
| Position | Middle |
| Organism | Panicum hallii var. hallii |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Panicinae> Panicum>
Panicum sect. Panicum.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.532 |
| Instability index | 62.80 |
| Isoelectric point | 9.54 |
| Molecular weight | 22657.81 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20242
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.96| 16| 19| 122| 140| 1
---------------------------------------------------------------------------
122- 140 (31.85/15.32) PP....PEPAPAPAPSQG.PatvP
142- 162 (26.11/ 7.35) PPsvstPVAPPVPAPSSSmP...P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 99.06| 19| 19| 54| 72| 2
---------------------------------------------------------------------------
24- 42 (33.19/22.08) LEFVQCLANPTYIHYLAQN
54- 72 (34.59/23.30) LKYLKYWQRPEYIKYIIYP
75- 93 (31.29/20.43) LFFLELLQNANFRNAMAHP
---------------------------------------------------------------------------
|