<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20236
| Description |
Uncharacterized protein |
| Sequence | MSSSNQMGSDGKFGRGPRELSGAVDLISRYKLLNHHSFFCKKPLPLAISDTNYLNNVVGDTEIRKGEGMELDQLFQNSYPNEKTAYIQPFDMETLGQAFQLRETAPVDLPSAEKGTPTISGKPKIKSKDKVKKHKKHKEKDRDKEKEQKKHKHRHKDRSKDKDKDKDKDKEKKKDKSGNHESGGDHSKKHEKKRKQEVTGSSASVQNHKKTQKHKNQ |
| Length | 217 |
| Position | Head |
| Organism | Panicum hallii var. hallii |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Panicinae> Panicum>
Panicum sect. Panicum.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.572 |
| Instability index | 24.76 |
| Isoelectric point | 9.76 |
| Molecular weight | 24825.67 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20236
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.98| 21| 21| 137| 157| 1
---------------------------------------------------------------------------
137- 157 (39.21/15.25) HKEKDRDKEKEQKKHKHRHKD
161- 181 (32.77/11.65) DKDKDKDKDKEKKKDKSGNHE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.46| 14| 19| 182| 196| 2
---------------------------------------------------------------------------
182- 196 (21.16/13.89) SGGDHsKKHEKKRKQ
204- 217 (25.30/12.42) SVQNH.KKTQKHKNQ
---------------------------------------------------------------------------
|