<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20235
Description |
Uncharacterized protein |
Sequence | MDHHHPQQPQQYGDPYRGLVPSPQPDHHLHALQYHHQPQPALMSPPQPQPQPGLMSPPQPQPQPGLMSPPQPQQHHHASLASHFHLLHLVTRLADTIGTGTRDQNFDALVEELTSQFARCQQLLNSISGTISSKSTTVEGQRQSLDETRQLLDQRKELITKYRSSVEDLLKGDTR |
Length | 175 |
Position | Middle |
Organism | Panicum hallii var. hallii |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Panicinae> Panicum>
Panicum sect. Panicum.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.935 |
Instability index | 68.33 |
Isoelectric point | 6.51 |
Molecular weight | 19728.78 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP20235
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 105.04| 21| 22| 29| 49| 1
---------------------------------------------------------------------------
4- 35 (28.94/ 8.91) HHPQqPqqygdpyrGLVPSPQPD..hhLHA.LQYH
36- 59 (37.98/13.81) HQPQ.P........ALMSPPQPQpqpgLMS..PPQ
60- 83 (38.13/13.89) PQPQ.P........GLMSPPQPQ..qhHHAsLASH
---------------------------------------------------------------------------
|