<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20230
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MPVAGIYWINTPLTTPPQNMVPLLADHLGKRHQPLYIGKWSLEHRLLRETVPSSSGTTTTTTTPPPSNNNPTSQSPQPHQQIPAGGNYMQYLELTHHPGKLIVSTPSAIVTLDREFELLVRSKLSALWSHRQTLRGEGLAYEVDDFKVRIANILQGEVWKGVLVEVEYAPCSVLAAAEGVIRGFVEGLGWPTGRFTFSGKGGGKRVEGEEWSVLDTGRQYCEVLRMGWGG |
| Length | 230 |
| Position | Head |
| Organism | Tuber borchii (White truffle) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Pezizomycetes>
Pezizales> Tuberaceae> Tuber.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.308 |
| Instability index | 39.06 |
| Isoelectric point | 7.06 |
| Molecular weight | 25369.58 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20230
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.05| 23| 46| 11| 35| 1
---------------------------------------------------------------------------
11- 35 (39.95/27.41) TPLTT.PPQNMVPllADHLGKRHQPL
59- 82 (40.10/22.01) TTTTTpPPSNNNP..TSQSPQPHQQI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 144.76| 44| 49| 134| 179| 2
---------------------------------------------------------------------------
134- 179 (70.36/41.76) LRG..EGLAYEVDDFKVR...IANILQGEVWKGVLVEVEYapCSVLAAAEG
181- 229 (74.40/38.84) IRGfvEGLGWPTGRFTFSgkgGGKRVEGEEWSVLDTGRQY..CEVLRMGWG
---------------------------------------------------------------------------
|