<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20206

Description Uncharacterized protein
SequenceMIPHSSAGVQPWGHPLRAVENVSGRIDASQTLGLADLASDKQSMPVLPPQPRHPAVINLTASAGDAQEREPPAKRLRLDASAGSDAKEASPASGSGGEARNNPGSIANPKPASLSWRGRPVWSFQALISEPPNGADPNEEDATLTPQGVRLASPPPFPLMPWRYTPPELSSCNATTSQDLVQVKQVQTTPYHIEVPSAAPVLKGDKVADFSPWTGNHPEDVLNEQTAKQGHYDRTQVSQNESNTARPSLYAQLKHRSGLHMLSSVFMAALEKRQTHNMVTAPSSFKPPPRVTLTDNKRELWLRDLANPSVPLRRLSRTIPHGIRGKALLDQCLSKWIPISRAVWLAKCVGANEIRAFKRKGTSGALAMGLEAKWVRDWTTGVQQFLEAVVGTCGSGDWKSKMTYAATLTARLFFERLLDHDQYITWFLASLESASLNVLPVWLLMLGIYWGCVLRYRKRGRRLAEILLEKLRQITQPRKPTSLQPLADRLSSYIKRLVLEHTSSVILPTSWERYKDLIYSCLNMKEQTDRAVFATLAERNSRVQVPKDRPETTQSAQHRVINLFDSIRSSHDISSTATACLTALEDKAALVFKLLEWSASPFRFGLCRVYTAARLLRKWKTFGVDIDSHIISFLGTFQDANQLSMENVYHVISELVRSQNFSISRYLQWLMAKGVANTSGSNNAHILSGDACLLSHLPMSRLPEHVRSLRHTLLFRAGISGSDEEITIEALKNSISRRLPKIFGAEMSNGGLIDASRPNLSWAVKSEVGIWIRSGVAKHYRDSSRKLLGDPLPIRVSALTPEEFYNIRDILESFGDLSILADVIKQATRCDDNVVLASAADTINYHFDAFGVIGATGDLFRGLLESYARLKRMGTLHLDFVFSLIELGLRIPQEMNMVTLLRQDLARMESKSALAAPSPLSDHIPMTLDEVDSSFQDKLDQLLSSGNGMDESTMSTVFGSLTRLLDHGSDASKLSANDICRYLAYVRPFNPKYFDALLLRWVCGLLKSPSSQSMMARILPPLIGVGCVTIPGFVNLVNKLLDPEKATPAVFNPTSLRLDLLELLIPRESKYADMVTYRFCLAQQEFLAKHPKTTLDIIRDAIPLIDSQYLETEPVTSRPDLAGCTTALLHTLLSQASDVVAQYCMQKFTIHPAFTRVLEKAVDVLLGFDSSSASHPVSEAEKVILMNNDFSLPFCQLKLQLLFNAGAGDDVKNSIVDVMFKAAVADSRSKNSHWIGLVNLMNQDAARQIRERAESSFFAIPLFDERADDASISTVADYSNSIENAKLYLGIIEKLAYSVPESGVQSVVPILVEKMDHLLQRLIIMQTNFNSFAENRHGISPDQIAQYRLNFERGLAFWFSALLRVTVLHRTAFTAPASLAAKTNNLHEQTRLLVSMFCISLARLPDNILRFFPTANYFPHPVPPEKLRPCPGILLQTHALDVAASLIDSFPDETRQQCARFLREKCPPFLQFQNDPRFLYLLGPMPDATAPNLPIPASLPSPAAGGSTPTPSGSLPSGASNNQAPPMAACSGIPYGTSDGVNCASDRLRLQHRGRIIGPYPVRPWELLEDAAPILGENDTAVSLKLFDTRSVRA
Length1594
PositionKinase
OrganismAspergillus ochraceoroseus IBT 24754
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Nidulantes.
Aromaticity0.07
Grand average of hydropathy-0.159
Instability index46.13
Isoelectric point8.54
Molecular weight176336.02
Publications
PubMed=29317534

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
ECO:0000256	ARBA:ARBA00002895
ECO:0000256	ARBA:ARBA00003744
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP20206
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.06|      12|      15|    1498|    1509|       1
---------------------------------------------------------------------------
 1498- 1509 (23.25/13.04)	SLPSPAAGGSTP
 1514- 1525 (22.81/12.63)	SLPSGASNNQAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.83|      17|      21|      48|      68|       2
---------------------------------------------------------------------------
   48-   68 (27.19/24.23)	PPQPRhpavINLTASAG.DAQE
   71-   88 (26.64/13.09)	PPAKR....LRLDASAGsDAKE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      72.39|      21|      21|    1073|    1093|       3
---------------------------------------------------------------------------
 1073- 1093 (37.58/23.34)	DMVTYRFCLAQQEFLAKHPKT
 1096- 1116 (34.81/21.08)	DIIRDAIPLIDSQYLETEPVT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      68.88|      16|      16|     251|     266|       4
---------------------------------------------------------------------------
  248-  263 (26.99/16.67)	SLY.AQLKHR..SGLHMLS
  264-  280 (22.78/12.89)	SVFmAALEKR..QTHNMVT
  883-  899 (19.12/ 9.61)	SLI..ELGLRipQEMNMVT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.30|      18|      21|     935|     955|       5
---------------------------------------------------------------------------
  935-  955 (22.77/22.17)	FqDKLDQLLSSGNgmDESTMS
  958-  975 (31.53/17.04)	F.GSLTRLLDHGS..DASKLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.84|      19|      21|      91|     109|       6
---------------------------------------------------------------------------
   91-  109 (35.23/18.72)	PASGS..GGEARNNPGSIANP
  111-  131 (30.61/15.28)	PASLSwrGRPVWSFQALISEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      89.68|      22|      23|    1028|    1049|       7
---------------------------------------------------------------------------
 1009- 1030 (35.62/21.79)	PSSQSM.MARILPPLIGVGCVTI
 1031- 1052 (35.10/21.36)	PGFVNL.VNKLLDPEKATPAVFN
 1053- 1072 (18.96/ 7.83)	PTSLRLdLLELLIPRESKYA...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.55|      11|      23|     629|     639|       8
---------------------------------------------------------------------------
  629-  639 (20.54/12.65)	HIISFLGTFQD
  650-  660 (19.01/11.18)	HVISELVRSQN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.21|      15|      17|     316|     332|       9
---------------------------------------------------------------------------
  316-  332 (22.47/19.72)	SRTIPhgIRGKALLDQC
  334-  348 (29.74/17.78)	SKWIP..ISRAVWLAKC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.37|      14|      23|     500|     513|      10
---------------------------------------------------------------------------
  500-  513 (25.58/14.92)	EHTSSVILPTSWER
  526-  539 (22.79/12.50)	EQTDRAVFATLAER
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.93|      15|      15|    1200|    1214|      11
---------------------------------------------------------------------------
 1200- 1214 (26.06/16.80)	QLLFNAGAGDD.VKNS
 1217- 1232 (20.86/11.98)	DVMFKAAVADSrSKNS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.63|      14|      85|    1397|    1413|      13
---------------------------------------------------------------------------
 1378- 1394 (16.54/ 9.74)	SLAAKTNNLheqTRLLV
 1400- 1413 (25.09/10.65)	SLARLPDNI...LRFFP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.73|      16|      19|     362|     378|      17
---------------------------------------------------------------------------
  362-  378 (26.27/20.10)	TSGALAMgLEA....KWVRDW
  379-  398 (25.47/13.99)	TTGVQQF.LEAvvgtCGSGDW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.31|      20|      21|     704|     723|      18
---------------------------------------------------------------------------
  685-  704 (32.18/18.74)	HILSGDACLLSHLPMSRLPE
  705-  724 (32.13/18.70)	HVRSLRHTLLFRAGISGSDE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.98|      19|      22|    1133|    1152|      19
---------------------------------------------------------------------------
 1133- 1152 (30.51/24.61)	LSQASDVVAQYCMQKFTiHP
 1158- 1176 (31.47/20.16)	LEKAVDVLLGFDSSSAS.HP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP20206 with Med12 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) DASQTLGLADLASDKQSMPVLPPQPRHPAVINLTASAGDAQEREPPAKRLRLDASAGSDAKEASPASGSGGEARNNPGSIANPKPASL
2) GDKVADFSPWTGNHPEDVLNEQTAKQGHYDRTQVSQNESNTARPSLY
3) PNLPIPASLPSPAAGGSTPTPSGSLPSGASNNQ
4) QALISEPPNGADPNEEDATLTPQGVRLASPPPFPLMPWRYTPPELSSCNATTSQDLVQVKQVQTTPYHIEVPSA
27
204
1491
125
114
250
1523
198










Molecular Recognition Features






MoRF SequenceStartStop




1) PAKRLRLDA
72
80