<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20201
Description |
Uncharacterized protein |
Sequence | MADILTQLQTCLDQLATQFYATLGYLTTYHDNSPATPPPNIPDAAPALARIQKNSTNPPIPAGAATVVASQQASPPPAPGAVPSVGVPGTATGGGADEGIVDPSLPPRPDSPRTFASRQRELARDLVIKEQQIEYLISVLPGIGSSEAQQEKRIRELEGELRLVEEERETKIKDLRRLRRRLEDVLGAVEVGIYGRR |
Length | 197 |
Position | Middle |
Organism | Aspergillus ochraceoroseus IBT 24754 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Nidulantes.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.418 |
Instability index | 67.32 |
Isoelectric point | 5.34 |
Molecular weight | 21234.75 |
Publications | PubMed=29317534
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP20201
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.65| 9| 17| 36| 45| 2
---------------------------------------------------------------------------
36- 45 (15.35/10.41) TPPPnIPDAA
56- 64 (19.30/ 8.59) TNPP.IPAGA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 106.52| 32| 32| 106| 137| 3
---------------------------------------------------------------------------
106- 137 (54.96/30.89) PPRPDSPRTFASRQRELARDLVIKEQQIEYLI
141- 172 (51.56/28.62) PGIGSSEAQQEKRIRELEGELRLVEEERETKI
---------------------------------------------------------------------------
|