<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20199
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MAGTQEPSSLEEILWRSPPHVQMMGGYLHSNNILFYFAESPFFDATSNNASLAIQANYNEAFRHFVETREAFEGRLKTMQGLEFVVAYDPLQAAAQSNTQFARDPSNIWVIRKQTRRKRAGLDDEVVVLATFFVVGDCIYMAPSVASVVGNRIVRELLLLGCFFFSTSAANIVLVLLSAVTSLTSLLKTASTLPIFTPSHGHTYLPPAPKSTDPSQPGVQSQGSKENTPMPDVDASSKAAAALVSSQAQQTSGSTFQDLKTLAESFNLLSRYGDEFMDENPLVGEPGSFILSKAGDTDRGATAKQPPPPSTIPGRVATPQVKVDTPGKTSEKAAPSGAEESKLRRKKSKLGS |
| Length | 352 |
| Position | Head |
| Organism | Aspergillus ochraceoroseus IBT 24754 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Nidulantes.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.236 |
| Instability index | 48.68 |
| Isoelectric point | 6.54 |
| Molecular weight | 37965.44 |
| Publications | PubMed=29317534
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 PIRNR:PIRNR013286
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20199
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.21| 18| 21| 253| 273| 1
---------------------------------------------------------------------------
255- 273 (27.88/23.86) TFQDLKTL.AE..SFnLLSRYG
275- 295 (24.33/ 9.18) EFMDENPLvGEpgSF.ILSKAG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.88| 12| 21| 138| 149| 2
---------------------------------------------------------------------------
138- 149 (21.91/15.94) CIYMAPSVASVV
162- 173 (21.97/16.00) CFFFSTSAANIV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.93| 21| 24| 199| 222| 3
---------------------------------------------------------------------------
202- 222 (39.46/24.04) HTYLPPAPKSTDPSQPGVQSQ
227- 247 (34.47/13.10) NTPMPDVDASSKAAAALVSSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.84| 12| 25| 296| 308| 4
---------------------------------------------------------------------------
296- 308 (18.98/14.54) DTDrGATAKQPPP
324- 335 (21.86/11.67) DTP.GKTSEKAAP
---------------------------------------------------------------------------
|