<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20197
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSNRASSASFRVGPPSPSSPAAFSLKENSLTASPPGQIPQTPTSPPLMSGSASNNASSFASLQASPSQATSQPANLSSPPSSTPMSTQASQQPTAGMTNSFPTPASSVDPDHIDKSFGASVSEIGAPSAASTSAAPSQQSEHRRTDHDRNFEGSQATTGVRDLANMASSTQAHHGDAMDIDTDNPNWPSLDSLQRDFSSAFHLCKSSHIATGPDPTLDLISLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKIDSTTAGGLRHMTMWPEEEWQNQKVYGKEIKVADIDSALYNLQMKAMKMESGTVPNNDYWEDVLGHEKPAKHVSNGEVAKKVAAAPNGVRVPTQTNGSSAPTDQERSRPSRGRKRHYDDNSFVGYGEGYADDDDDGAYYSNGEGVGKKKRKKDHVSKISTPLPERGGSYGVGMFGIGAR |
| Length | 446 |
| Position | Head |
| Organism | Aspergillus ochraceoroseus IBT 24754 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Nidulantes.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.757 |
| Instability index | 47.52 |
| Isoelectric point | 7.22 |
| Molecular weight | 47291.52 |
| Publications | PubMed=29317534
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20197
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 91.47| 28| 31| 16| 46| 1
---------------------------------------------------------------------------
16- 45 (47.31/28.65) S..PSSPAAFSLKENSLTASPPgqIPQTPTSP
81- 110 (44.16/17.00) SstPMSTQASQQPTAGMTNSFP..TPASSVDP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 130.39| 29| 31| 114| 142| 2
---------------------------------------------------------------------------
114- 142 (48.49/22.37) DKSFGASVSEIGAPSAAS.....TSAAPSQQSEH
148- 174 (41.78/18.38) DRNFEGSQATTGVRDLA.......NMASSTQAHH
176- 208 (40.12/17.39) D.AMDIDTDNPNWPSLDSlqrdfSSAFHLCKSSH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.26| 21| 32| 261| 281| 4
---------------------------------------------------------------------------
261- 281 (37.81/23.21) GRN.KPVKIDSTTAG.GLRHMTM
294- 316 (27.45/15.07) GKEiKVADIDSALYNlQMKAMKM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.80| 13| 49| 2| 14| 5
---------------------------------------------------------------------------
2- 14 (24.61/13.17) SNRASS.ASFRVGP
53- 66 (19.19/ 8.73) SNNASSfASLQASP
---------------------------------------------------------------------------
|