<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20187
| Description |
Uncharacterized protein |
| Sequence | MDSTSSTNLLDKHNKLIFEILRSYRDLMNCATVQGMDKANQNDFEAQTTKLNYRDPDTMAAAEIRTQRKFDQLHDNIKELLALSRTIKELWVFGPLDRADGHRQEKEVQIDRDVQEVSRLMDNFDMKAMRELAGQFGGTYEPQAATAATAATASSSSVVTTTEPAPATGN |
| Length | 170 |
| Position | Head |
| Organism | Fusarium culmorum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.648 |
| Instability index | 31.19 |
| Isoelectric point | 5.09 |
| Molecular weight | 19017.01 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20187
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.22| 22| 28| 11| 38| 1
---------------------------------------------------------------------------
1- 35 (27.53/33.67) MDStsstnllDKHNKLifeilrSYR..DLMNCATVQG
36- 66 (26.70/17.63) MDKanqndfeAQTTKL......NYRdpDTMAAAEIRT
---------------------------------------------------------------------------
|