<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20181

Description Mediator of RNA polymerase II transcription subunit 13
SequenceMETSEYETNTLSINNIASIAFRIYEPSTDQSHSFQSSALEIQSTFRDQGKLVSYDADRGGIWIFQITNKDGASKAVSFGSGVSLEACGYTLGMVDEGTLEPAALQKNRIPGNTTQNAPTNTAATTSPAEPHQRNPLISPIQTAGVQAEGAQLPAQPVDTRTTQPVPNIIYEQFIIAVISSITLAFCSQSMAVPLNYRTILIPPLQADTNEHERDSLPTDPVIGTFKTYLTTTGSLVVSLYFSYCQNLATVEDVLSGDSLSPSGSILAAPYGVFATKSGFSNGDIDRNLAQTPNTQALSVRSVPDAHDSLWKHSCLKALEYCGLNPSNFKAGSWVNLLITKPTSQDVDGEQKRLRATVPWPGALCFRKKPLEVSTTHRVGDTILSGHEECHDPLGDARGWFASASEREERVSKRKAERAHAAPKEVNGANLQAQSLSGQSPLSVRRPSTATAGVMYPTPPDAIQQHLGVTPSIDGATSSPNNPPPNLAVADADITMPTVTPMADVDNDVWEGGHEQKRARSDSNLLGDTEDIMNDMGGDVFGDHDVTEDDFNFFDGPDGNDMDIDMSDLQPISHQIPHPPPPQAIPPQAMPLQAMPPPMIMQPLPQKVIEPQPEIKLKPRPRPKPKIHEPVFAKPKLKHARSSLNDELNHKVKTERSNSNKRGSSPFDPDTVFKRVKASLASPTQENFTFQAPLRRKSSIFEKVEFDPKIPLINKKYEHGGAFDFSKDLGSGELKRDTEGLSRDEYLERQGKLNPDSKIFPGVSLIRSLTGADGSANHANAQKSNCNASFSEDSDVDSEADDLSSLSGGPASPIKSSVKRTVVDDDALSQATTSREAELMDDATEEQLAIELPKLSKTESYEMPLHRFFSDPEPLNAEVGLSNNEFVEVAQIVTEQAATGRLDIGIDHKNGSSVALATMKGHELNVARSSLQLLHNVIPSNLGSATAVRLKGLLEILDLPLAGQPTRLQPRPIPGRDTNVEQLRANNLYQIPVPHLEVRRSETKLSVLPSSVSFWEGLGLSPSWGPKDITALCIFPGWKGMSDHVGSFIDRLKSVYESLKLGTFNNLPLSGDWDDGVLPYEVDRISTSPDATVTGHGSSLVESMEVLRSSLSELKSKDKNLVIYFVYSPDNPASIIEACTAFYRCFGEYSELLADRRESPQNELVLQLVSSNLISSTTSLVVPTPAEMIKLCVETYDRCTLFLGAEYGGPTPAPAVMLEQPPPRMIDFKLTTSPSQSLMHENSCIHVGYAESLDGRWITAAWTDNRGQRQATASYSIMRSRTPDRSTSHHKAAIIAEIWATTLTMISIWKVHWRVIITRSGPMDQKEVEWWQAASTLDDKYSFTMVLMSVDTSPSLQLVPPVVKIPHAATSAFYSTPVSTPQANIVSPEQTTTPATPMREASTLAATPGAESATEPDADSFLIDVTDQTWGAISGHRFGNSTTLLEMRPALASGYLIKRTGIKIEDPPVVMEVNLVHTEATPRAYEPLLREMLCYFRGLGTLARARGVTDRETDVRPWHIAVAEKGVRALHLLL
Length1533
PositionKinase
OrganismFusarium culmorum
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium.
Aromaticity0.06
Grand average of hydropathy-0.371
Instability index45.86
Isoelectric point5.28
Molecular weight167259.23
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP20181
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.49|       9|      20|    1014|    1024|       1
---------------------------------------------------------------------------
 1014- 1024 (15.81/15.76)	WEglGLSPSWG
 1037- 1045 (19.68/11.13)	WK..GMSDHVG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     261.67|      79|     110|     282|     362|       2
---------------------------------------------------------------------------
  282-  362 (135.42/98.58)	GDIDRNLAQ.TPNTQALSVRSVPDAH..DSLWKHSCLKALEYCGLNPSNFKAGSWVNLLITKPTSQdvDGEQKRLRATVPWPGA
  394-  475 (126.25/85.48)	GDARGWFASaSEREERVSKRKAERAHaaPKEVNGANLQAQSLSGQSPLSVRRPSTATAGVMYPTPP..DAIQQHLGVTPSIDGA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      30.59|      10|      29|     910|     920|       3
---------------------------------------------------------------------------
  910-  920 (13.37/11.51)	GSSVALaTMKG
  942-  951 (17.21/ 9.50)	GSATAV.RLKG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     105.14|      30|      95|     583|     616|       6
---------------------------------------------------------------------------
  139-  168 (46.20/18.08)	PIQTAGVQAEGAQLPAQPVDTRTTQPVPNI
  585-  614 (58.94/39.49)	PPQAMPLQAMPPPMIMQPLPQKVIEPQPEI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.13|      16|      25|     521|     538|       7
---------------------------------------------------------------------------
  521-  538 (22.05/20.76)	DSNLLgDTEDiMNDMGGD
  549-  564 (33.08/19.44)	DFNFF.DGPD.GNDMDID
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.51|      13|      15|     692|     706|       8
---------------------------------------------------------------------------
  692-  706 (18.94/18.86)	PLRRKSsiFEK.VEFD
  710-  723 (20.58/12.56)	PLINKK..YEHgGAFD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.01|      15|     861|     101|     115|      12
---------------------------------------------------------------------------
  101-  115 (27.89/17.57)	PAALQKNRIPGNTTQ
  964-  978 (30.11/19.68)	PTRLQPRPIPGRDTN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.66|      23|      23|    1065|    1087|      16
---------------------------------------------------------------------------
 1065- 1087 (41.55/27.48)	NLPLSGDWDDGVLPYEVDRISTS
 1089- 1111 (37.12/23.67)	DATVTGHGSSLVESMEVLRSSLS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP20181 with Med13 domain of Kingdom Fungi
Unable to open file!