Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MAALGLDDDELKSVEQTLARLAQLSSSIQSLKMDILKSNPLPHPSSLQASAQILQRNLQTVLDNLSENSELFSRIAVHPSTNYPGRTQENVLTQLLRKKLEPDVEELVAQGRETARLVTPEGIAELQNIWDELRAWTQSRIATYVKEEAEDVYTKAEREMGIDKVRTGLRKGLDEESDEEDDEDEDEDDDNEDMDEANDGDPAKSTLVGRGPEPETLLWFAARGDFELPRNIEYENKHAVKRGFDGVNIPPGSGLS |
Length | 256 |
Position | Head |
Organism | Trichoderma longibrachiatum ATCC 18648 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.768 |
Instability index | 51.60 |
Isoelectric point | 4.39 |
Molecular weight | 28628.18 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP20159 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 82.26| 27| 39| 52| 79| 3 --------------------------------------------------------------------------- 52- 79 (39.58/32.29) QILQRNLQTVLDNLSENSELFSRIaVHP 94- 120 (42.67/29.85) QLLRKKLEPDVEELVAQGRETARL.VTP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AKSTLVGRGPEPETLLWFAARGDFELPRNIEYENKH 2) DMDEA | 203 193 | 238 197 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab