Description | CSE2-domain-containing protein |
Sequence | MGDRLTQLQDAVDQFAQQLVACMHFVQMRHDLEKLGPNDKIREPKEQAAKEVDALPPQDFRAGLVELSRDLIVKEQQIEVLISTLPGLDNSEQDQERHIRDLEEDLKTAEAQRVEALREKDLILTQLDAIIRNIRRP |
Length | 137 |
Position | Middle |
Organism | Trichoderma citrinoviride |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma. |
Aromaticity | 0.02 |
Grand average of hydropathy | -0.627 |
Instability index | 60.52 |
Isoelectric point | 4.83 |
Molecular weight | 15800.76 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP20155 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 83.62| 28| 33| 47| 79| 1 --------------------------------------------------------------------------- 52- 79 (46.87/27.26) VDALP.....PQDFRAGLVELSRDLIVKE.QQIE 82- 115 (36.75/13.03) ISTLPgldnsEQDQERHIRDLEEDLKTAEaQRVE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DQERHIRDLE 2) LVELSRDL 3) NDKIREPKEQAAKEVDALPP 4) TLPGL | 94 64 38 84 | 103 71 57 88 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab