<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20151
| Description |
Pkinase-domain-containing protein |
| Sequence | MPLRLKPGYPHSSSSHHFFGSSSSSSSAHRSYTDGRDQSAGYQPKARVTERYRIIGFISSGTYGRVYKAVGRTVNGEGIAVVKTSSGLTPTSGSGSGSSAPIEVAIKKFKPDKEGEQVSYTGISQSAIREMSLCSELRHANVIRLVEIILEDKCIFMVFEYAEHDLLQIIHHHTQQPRHPIPPATVKSIMFQLLNGCQYLHTNWVLHRDLKPANIMVTSGGEVKIGDLGLARRFDKPLHSLFSGDKVVVTIWYRAPELILGSYHYTPAIDMWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMHKIAEIMGMPTKERWPLLPAMPEYMQLNTLSAMQHSSHSSHHHGHHQQPPSRGYSTTSSLEKWYYSTINNNSGAGSAASGPNGQPALQSLGAEGYKLLAGLLEYDPEKRLTAAQALQSVFFSTGDRVSANCFEGVKVEYPHRRVSQDDNDIRTSSLPGTKRSGLPDDTLLRPAKRMKD |
| Length | 486 |
| Position | Kinase |
| Organism | Trichoderma citrinoviride |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.435 |
| Instability index | 46.08 |
| Isoelectric point | 9.24 |
| Molecular weight | 53847.54 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP20151
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.37| 22| 78| 316| 342| 1
---------------------------------------------------------------------------
321- 342 (42.03/28.91) ERWPLLPAMPEYMQLNTLSAMQ
401- 422 (37.35/15.01) EGYKLLAGLLEYDPEKRLTAAQ
---------------------------------------------------------------------------
|