<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20150

Description Mediator of RNA polymerase II transcription subunit 19
SequenceMSFHPQTPQSPSQFSPATSSDPSLGSSGSVAVAGSGTTTLPTPAHSVNGSYSHPDSIMLDDSPHKRKRPLEDVGDDRELKKAHVDDDKPALEDLHLDVGSKYLLLQSPHPESLPRTSEDLYEMFDLTGLAAEVAREKPNGEKNALRKTYKGHIKRLGVAGHFDVQKKKEDSPSDFLAMLQVPDHEWNVHQVKGRNLMDGLSEMTKASLSRALTMAKGPIAKSVWDTSVLGDVGSNGDSSKAPSAKPTAPNTPLISMPGAAMNRPKAPLLPGQSPARPQRSIKKRSYGDSSYEGYGEGFPDDDTGLETGYSTGEGEGGQKRRKKATTPPYPSAMRQSSYGPGMVGV
Length345
PositionHead
OrganismTrichoderma citrinoviride
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma.
Aromaticity0.05
Grand average of hydropathy-0.781
Instability index52.09
Isoelectric point6.84
Molecular weight36972.81
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
ECO:0000256	RuleBase:RU364151
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP20150
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     107.19|      23|      23|     220|     242|       1
---------------------------------------------------------------------------
  220-  242 (38.60/18.53)	AK.SVWDTSVLGDVGSNGDSSKAP
  244-  267 (32.98/14.91)	AKpTAPNTPLISMPGAAMNRPKAP
  278-  299 (35.61/16.60)	QR.SIKKRS.YGDSSYEGYGEGFP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.38|      16|      24|      60|      83|       2
---------------------------------------------------------------------------
   60-   76 (26.45/11.80)	DDSPHKRKRPLeDVGDD
   86-  101 (27.94/18.50)	DDKPALEDLHL.DVGSK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.96|      21|      21|     156|     176|       3
---------------------------------------------------------------------------
  156-  176 (34.69/19.83)	LGVAGH.FDVQKKKEDSPSDFL
  179-  200 (33.27/18.77)	LQVPDHeWNVHQVKGRNLMDGL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.72|      15|      24|      16|      30|       4
---------------------------------------------------------------------------
   16-   30 (26.10/12.32)	PATSSDPSLGSSGSV
   43-   57 (28.62/14.17)	PAHSVNGSYSHPDSI
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP20150 with Med19 domain of Kingdom Fungi

Intrinsically Disordered Regions

IDR SequenceStartStop
1) DTSVLGDVGSNGDSSKAPSAKPTAPNTPLISMPGAAMNRPKAPLLPGQSPARPQRSIKKRSYGDSSYEGYGEGFPDDDTGLETGYSTGEGEGGQKRRKKATTPPYPSAMRQSSYGPGMVGV
2) MSFHPQTPQSPSQFSPATSSDPSLGSSGSVAVAGSGTTTLPTPAHSVNGSYSHPDSIMLDDSPHKRKRPLEDVGDDRELKKAHVDDDKPALE
225
1
345
92

Molecular Recognition Features

MoRF SequenceStartStop
1) GQKRRKKATTPPYPSAMRQ
317
335