<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20140

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMDRRNTAREALRDSVKCWSDFVAKCLTKRLDAGPFEDYVKLVFAKHPLTPEVIADFLLQPQAANCVSPDPRIPPYVSVLTHLRYVDAVSILRSLYRYSSLHAQTPLQAQEQEQGQGQGQGQQQEQEQKQLQEREQEQEQGQEREREERENAPAKEQEHEKALLSDAKHDAQHDALRPSRTRWKSSSWLEEVMFYHVIRLVVEGTAFKDSRTALELIHVTSKWMSLFAAASNSMAAEVLSGTLQDPQVRHDMEVSRAAFVPLLLRLVDNPALVKVISHPSAKAPRKEFSDSLTSFVHVFQPVPPFVEKLEMFRTEVLAPLDPVDKNSQAANAMDELLDSTVGLDNLMIPDMPITNTRAGLYVYLGASLVGRPLIDDHAFFSYLNNRYQGNNQQSAIDLILASFDLLANAVFRNEGPRDAHLLRSFLTNKVPLILGQLCPPGFSTPSAEFCITQALSQVDTSVFPTASLMFDESRNNNPYTESVREEFCSACALHGLIEREHVERILGESSMSYEPSQEKYSKEKLVQNCLSDPDKIQALVRDMDKMDGNVGAVCQALVELLRQLCNSKETMSLKILCNQLVQKPQSLDVLLLFEKLPTILDPICQLLDGWRYEEDQGEYQPVYEEFGAILLLVLAFAYRYSLYPADIGILATDSSVAKIIGRAHISRGLDRLSEQEHGHLGGWIHGLFDSDAGGLGDDLMSSCPPAEFYLLIATLFENIVMAYTQGSLTDDSLKSGVEYLVDTFLLPSLIPAIRFLSDYLWVEQREQKSIIKILQLILLPTSISGEASTMLASVKGIVAKPLEHSLRAYQRQDPKNQDIEPLLRALKDSLPHSRRTGAAEHQELEMWTASSSSGLAGAAKHLIQNLVQWGMHPEMTAMPTSYTHRQMIATLKIVGASRLLRVMLEEIRQQTLAGSGSIAYDVVTALVCAPNVSNELPLTSGLLDETGSLPPPLQRRLTLREVLKMEAENYRKLHKKDPELAEITVRLYRRVEAQLVLPPPPTMLQAADMQLDLAGDATGLGDPMAAAAGVQGDGTMAIDGVGNLDMSIGGVSADMGLGASGNSGGLDASAEADLFGGLDTDMDVFDGWSGMDLSRP
Length1095
PositionTail
OrganismTrichoderma citrinoviride
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma.
Aromaticity0.06
Grand average of hydropathy-0.208
Instability index45.48
Isoelectric point5.03
Molecular weight121245.68
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP20140
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      78.99|      17|      19|    1005|    1021|       1
---------------------------------------------------------------------------
 1005- 1021 (31.34/20.62)	AADMQLDLAGDATGLGD
 1026- 1042 (27.09/16.66)	AAGVQGDGTMAIDGVGN
 1051- 1065 (20.56/10.59)	SADMGLGASGNSGGL..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.91|      25|      45|     668|     707|       2
---------------------------------------------------------------------------
  668-  707 (37.89/59.67)	LdrlseqehghlggwiHGLFDS.....DAGGLGDD.............LMSSCPPA.EF
  711-  754 (23.02/11.24)	I...............ATLFENivmayTQGSLTDDslksgveylvdtfLLPSLIPAiRF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.87|      15|      15|     289|     303|       3
---------------------------------------------------------------------------
  289-  303 (28.11/19.38)	DSLTSF.VHVFQPVPP
  306-  321 (21.76/13.19)	EKLEMFrTEVLAPLDP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.26|      15|      19|     832|     846|       4
---------------------------------------------------------------------------
  832-  846 (29.42/20.94)	SRRTGAAEH..QELEMW
  852-  868 (23.84/15.48)	SGLAGAAKHliQNLVQW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.33|      16|      19|     433|     448|       5
---------------------------------------------------------------------------
  433-  448 (31.35/17.31)	LGQLCPPGFSTPSAEF
  454-  469 (27.98/14.71)	LSQVDTSVFPTASLMF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     132.50|      41|      48|     515|     556|       6
---------------------------------------------------------------------------
  515-  556 (64.73/46.94)	SQEKYSKEKLVQNCLSDPDKIQALVRdMDKMDGNVGAVCQAL
  566-  606 (67.77/44.35)	SKETMSLKILCNQLVQKPQSLDVLLL.FEKLPTILDPICQLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      50.36|      12|      19|     398|     409|       7
---------------------------------------------------------------------------
  377-  386 (13.61/ 6.58)	..AFFSYLNNRY
  398-  409 (19.75/13.19)	ILASFDLLANAV
  420-  429 (17.00/10.22)	LLRSF..LTNKV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.56|      22|      30|     103|     132|       9
---------------------------------------------------------------------------
  110-  132 (35.18/29.11)	EQEQGQGQGQgQQQEQEQKQLQE
  134-  155 (38.38/14.21)	EQEQEQGQER.EREERENAPAKE
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP20140 with Med5 domain of Kingdom Fungi

Unable to open file!