| Description | Uncharacterized protein |
| Sequence | MGDRLTQLQDAVDQFAQQLVASLHFVHMRHDLEPLGPKDKIREPKEQVPKEVDALPPQDFRAGLVELARDLIVKEQQIEVLISTLPGLDNSEQDQERHIKDLEEDLKTAEAQRVEALKERDHILKQLDSTIRIIRRP |
| Length | 137 |
| Position | Middle |
| Organism | Trichoderma harzianum CBS 226.95 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma. |
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.678 |
| Instability index | 51.75 |
| Isoelectric point | 5.12 |
| Molecular weight | 15822.81 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats |
>MDP20138
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.15| 28| 33| 47| 79| 1
---------------------------------------------------------------------------
52- 79 (46.67/29.02) VDALP.....PQDFRAGLVELARDLIVKE.QQIE
82- 115 (36.47/13.34) ISTLPgldnsEQDQERHIKDLEEDLKTAEaQRVE
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DQERHIKDLEE 2) GPKDKIREPKEQVPKEVDAL 3) IRIIRRP 4) LVELARDLIVK 5) STLPGL | 94 36 131 64 83 | 104 55 137 74 88 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab