<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20133
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MANPNDPPLDEIQWRSPQIVAQMGGLHSNTILFYFAESPFFERTSNNAVIMAQAMNNMAMYHYIQTREAFETRLKTMSGLEFIVGEEPAETGPGMGTGVWVIRKQTRRKRYQDDDEITVHASFFVVGENIYMAPTLADILASRIMTISSAIAKALPAAEAARKWRPSTGHVYQLPASQSSTQPKPQEFKEEKPVLDEAGKPLSAVAKHDAPFMDRVAEESFMIHLRYGGEYIDEIPITGKPGEFHLSSTGRKPVLPPQGAAPTGISAMSGPPMLNTKLDDKKDGRPDKTPKSATMPKLKRKKSKMSPSVTPAATPGAS |
| Length | 318 |
| Position | Head |
| Organism | Trichoderma harzianum CBS 226.95 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.477 |
| Instability index | 52.94 |
| Isoelectric point | 8.86 |
| Molecular weight | 34931.57 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20133
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.31| 24| 147| 68| 94| 1
---------------------------------------------------------------------------
68- 94 (34.10/33.80) EAFETRLKtmSGLEFIvGEEPAETGPG
219- 242 (46.21/31.66) ESFMIHLR..YGGEYI.DEIPITGKPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.10| 12| 17| 155| 170| 2
---------------------------------------------------------------------------
155- 166 (22.30/16.86) LPAAEAARKWRP
174- 185 (21.80/ 6.04) LPASQSSTQPKP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 93.75| 27| 58| 187| 213| 3
---------------------------------------------------------------------------
187- 213 (47.57/24.86) EFK....EEKPVLDEAGKPLSAVAKHDAPFM
243- 273 (46.18/23.95) EFHlsstGRKPVLPPQGAAPTGISAMSGPPM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.83| 17| 17| 278| 294| 4
---------------------------------------------------------------------------
278- 294 (29.11/17.54) LDDKKDGRPDKTPKSAT
298- 314 (27.72/16.37) LKRKKSKMSPSVTPAAT
---------------------------------------------------------------------------
|