<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20130
| Description |
Uncharacterized protein |
| Sequence | MPLRLRPGYPHSSSSHHLFASSSSSSSSAHRLYTDGRDQSAGYQPKARVTERYRIIGFISSGTYGRVYKAVSRASNGEGIAAPIEVAIKKFKPDKEGEQVSYTGISQSAIREMSLCSELRHSNVIRLVEIILEDKCIFMVFEYAEHDLLQIIHHHTQQPRHPIPPATVKSIMFQLLNGCQYLHTNWVLHRDLKPANIMVTSGGEVKIGDLGLARRFDKPLHSLFSGDKVVVTIWYRAPELILGSYHYTPAIDMWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMHKIAEIMGMPTKERWPLLPAMPEYIQLNTLSAMQHSTHSHHHHSHHQNPPSRGYATTSSLEKWYYSTINNNSGAGSAASGPNGQPALQSLGAEGYKLLAGLLEYDPEKRLTAAQALQSVFFSSGDRVSANCFEGVKVEYPHRRVSQDDNDIRTSSLPGTKRSGLPDDTLLRPAKRMKE |
| Length | 468 |
| Position | Kinase |
| Organism | Trichoderma harzianum CBS 226.95 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.439 |
| Instability index | 46.99 |
| Isoelectric point | 9.19 |
| Molecular weight | 52340.95 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP20130
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.50| 17| 176| 153| 171| 1
---------------------------------------------------------------------------
153- 171 (31.09/22.38) HHHtqQPRHPIPP....ATVKSI
330- 350 (30.40/15.72) HHH..HSHHQNPPsrgyATTSSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.15| 17| 32| 26| 42| 2
---------------------------------------------------------------------------
26- 42 (30.17/19.71) SSSAH.RLYTDGRDQSAG
60- 77 (24.98/15.15) SSGTYgRVYKAVSRASNG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.33| 12| 185| 218| 229| 4
---------------------------------------------------------------------------
218- 229 (23.12/13.72) KPLHSLF..SGDKV
404- 417 (17.21/ 8.64) QALQSVFfsSGDRV
---------------------------------------------------------------------------
|