Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDTYIDGRFERLEKALATLIDSVTKYHPSAIQAEELKAADNELCKGLEQVEIHQNNHLKILQLRQLSASLDAQIRETLTCLATTRKDIVNTQVTIYPTEPNFPIVYEELLGHARRISKTSMPPAAILNAMAATQESQTPLPDSQAQSAMTPSAQTPNPMQSPAPTNGTIEQSAQQAQAALHTTLPDQMTQFLNPLSGQLFFPWPLEDKIRSGALASNQILLEQGIDPRGYDPVAEEDRKRKEEEERKEKEEKEKQERVEREKEAERQRQERQRQIEKQQAEWRRASMAVGASGEAAVAAPPSAKAEKKQFQFTNLDDLDNDDDED |
Length | 325 |
Position | Middle |
Organism | Trichoderma harzianum CBS 226.95 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.854 |
Instability index | 50.95 |
Isoelectric point | 4.93 |
Molecular weight | 36583.36 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP20128 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 38.54| 11| 16| 129| 143| 1 --------------------------------------------------------------------------- 129- 141 (16.74/15.90) AMaaTQESQTPLP 148- 158 (21.80/ 7.09) AM..TPSAQTPNP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 51.80| 16| 16| 240| 255| 2 --------------------------------------------------------------------------- 240- 255 (25.50/14.36) RKEEEERKEKEEKEKQ 257- 272 (26.30/15.03) RVEREKEAERQRQERQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EKQQAEWRRASMAV 2) GEAAVAAPPSAKAEKKQFQFTNLDDLDNDDDED | 276 293 | 289 325 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab