<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20126

Description Mediator of RNA polymerase II transcription subunit 19
SequenceMSFHPQTPQSPSQFSPATSSDPSLGSSGSVAAAGTGTTTLPTPAHSVNGSSSHPDSIMLDDSPHKRKRPLEDVGDDRDLKKAHIDDYKLAIEDLHQDVGLKYLLLKTPHPESLPSTSEDLYDMFDLANLAAEVAREKPNGEKNALRKTYKGHIKRLGVTGHFDVQKKKEDSPSDFLAMLQVPDHEWNVHMVKGRSLMDGLSELTQSSLGRALTMAKGPVAKSVWDTSVLGDIGPSNGDSSKAPSAKPTAPNTPLISMPGAAINRHKSQLSSGSNAARPQRSIKKRSYGDSSYEGYGEGFPDDDTGLETGYSTGEGEGGQKRRKKASENPNSDAAGNTPPYPSAMRQSSYGPGMVGV
Length356
PositionHead
OrganismTrichoderma harzianum CBS 226.95
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma.
Aromaticity0.05
Grand average of hydropathy-0.784
Instability index53.19
Isoelectric point6.46
Molecular weight37965.61
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
ECO:0000256	RuleBase:RU364146
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP20126
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.62|      22|      24|     156|     179|       2
---------------------------------------------------------------------------
  158-  179 (38.75/23.70)	VTGH.FDVQKKKEDSPSDFLAML
  181-  203 (36.87/16.42)	VPDHeWNVHMVKGRSLMDGLSEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.07|      14|      19|     258|     272|       4
---------------------------------------------------------------------------
  258-  271 (23.75/14.27)	PGAAINRHKSQLSS
  278-  291 (24.32/ 9.47)	PQRSIKKRSYGDSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.81|      15|      24|      16|      30|       5
---------------------------------------------------------------------------
   16-   30 (26.01/11.63)	PATSSDPSLGSSGSV
   43-   57 (27.80/12.91)	PAHSVNGSSSHPDSI
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP20126 with Med19 domain of Kingdom Fungi

Intrinsically Disordered Regions

IDR SequenceStartStop
1) DTSVLGDIGPSNGDSSKAPSAKPTAPNTPLISMPGAAINRHKSQLSSGSNAARPQRSIKKRSYGDSSYEGYGEGFPDDDTGLETGYSTGEGEGGQKRRKKASENPNSDAAGNTPPYPSAMRQSSYGPGMVGV
2) MSFHPQTPQSPSQFSPATSSDPSLGSSGSVAAAGTGTTTLPTPAHSVNGSSSHPDSIMLDDSPHKRKRPLEDVGDDRDL
225
1
356
79

Molecular Recognition Features

MoRF SequenceStartStop
1) GQKRRKKASEN
318
328