<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20118

Description Uncharacterized protein
SequenceMVYFPGTQYRSHTSCMSEEQKYQGALYKPKQNKQQQQQQQKQQQQQNQQPNMNSRRSDMANTLALQPFVEDIGEDKEYESWHEYEVHDNQSPPPRAPSPPTASGDEHVNVFDFLDNSQTPTASNVSRPRERRAPDTSDATSLVRYESKTGELLEPAALMDQDKEPLVQYGTGPVPTSFATPHAKTERRKSREGDLKKDKKRKRLHVDVAGDQIMADAPPVLHSGLTGGLKNMMRPDFPPSPDYSGDNIAESPTSPLKKTKHTRHHKSHHHHTMNNSIFGMISGSPPKVKSSKHKSSSKKHSHHKHDKKEPKLIEYRPSSKEGKRENLDGQMIVFKPRADVFLSFVNKGPESERGCSMNKALKRFHRERQAVGASTPKIKDEKELWRSLRLRRNDRGEIVLFSI
Length403
PositionTail
OrganismTrichoderma asperellum CBS 433.97
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma.
Aromaticity0.06
Grand average of hydropathy-1.208
Instability index60.51
Isoelectric point9.57
Molecular weight45949.94
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-KW

GO - Biological Function
DNA binding	GO:0003677	IEA:InterPro
metal ion binding	GO:0046872	IEA:UniProtKB-KW

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP20118
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.26|      20|      31|     251|     281|       1
---------------------------------------------------------------------------
  251-  271 (35.98/38.99)	SPtSPLKKTKHTRHHKSHHHH
  284-  303 (37.28/14.47)	SP.PKVKSSKHKSSSKKHSHH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.51|      10|      33|      94|     103|       2
---------------------------------------------------------------------------
   94-  103 (19.64/10.76)	PRAPSPPTAS
  128-  137 (18.87/10.04)	PRERRAPDTS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     129.14|      39|     163|     174|     213|       4
---------------------------------------------------------------------------
  174-  213 (61.45/46.21)	VPTSFATPHAKTERRKSREGDLKKdKKRKRLHVDVAGDQI
  340-  378 (67.69/46.08)	VFLSFVNKGPESERGCSMNKALKR.FHRERQAVGASTPKI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP20118 with Med15 domain of Kingdom Fungi
Unable to open file!