<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20112

Description Mediator of RNA polymerase II transcription subunit 6
SequenceMSNPNDPPLDEIQWRSPQIVAQMGGLHSNTILFYFAESPFFERTSNNAVIMAQAMNNMAMYHYIQTREAFETRLKTMSGLEFIVGEEPAETGPGMGTGVWVIRKQTRRKRYQDDDEITVHASFFVVGENIYMAPTLADILAARIMTISSAIAKALPAAEAARKWRPSTGHVYHLPASQSTTTPAKPQEEKPVLDEAGKSAPTTATKHDAPSMDRVAEESLLIHLRYGGEYIDEIPITGKPGEFHLSSTGRKPVLPPQGAAAPTGISAMSGPPMLNTKLDDKKDGKADKTPKSATMPKLKRKKSKMSPSVTPAATPAAS
Length318
PositionHead
OrganismTrichoderma asperellum CBS 433.97
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma.
Aromaticity0.06
Grand average of hydropathy-0.456
Instability index54.63
Isoelectric point8.86
Molecular weight34604.13
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364143

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP20112
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.14|      17|      18|     141|     157|       1
---------------------------------------------------------------------------
  141-  157 (27.69/15.08)	AARIMTISSAIAKALPA
  160-  176 (33.46/19.42)	AARKWRPSTGHVYHLPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.01|      16|      18|     178|     194|       2
---------------------------------------------------------------------------
  178-  194 (23.69/16.63)	QSTTTPAkPQEEKPVLD
  198-  213 (28.31/15.54)	KSAPTTA.TKHDAPSMD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.18|      18|      18|     277|     294|       3
---------------------------------------------------------------------------
  277-  294 (29.64/16.19)	KLDDKKDGKADKTPKSAT
  297-  314 (29.54/16.11)	KLKRKKSKMSPSVTPAAT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.03|      18|      18|     235|     252|       4
---------------------------------------------------------------------------
  235-  252 (32.86/17.54)	PITGKPGEFHLSSTGRKP
  255-  272 (33.16/17.76)	PPQGAAAPTGISAMSGPP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP20112 with Med6 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) PSTGHVYHLPASQSTTTPAKPQEEKPVLDEAGKSAPTTATKHDAPSMDR
2) TGKPGEFHLSSTGRKPVLPPQGAAAPTGISAMSGPPMLNTKLDDKKDGKADKTPKSATMPKLKRKKSKMSPSVTPAATPAAS
166
237
214
318










Molecular Recognition Features






MoRF SequenceStartStop




1) MLNTKLDDKKDGKADKTPKSATMPKLKRKKSKMSPSVTPAATPAAS
273
318