<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20100

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMEGRLTVSEALRDSIKYWSKFVSKCLTKRLDASTFEDYVRLVQSKHRLPPEIIADFFMRPLKSRCFSPDPRIPPYVSVLTKLRYTDAVSILRALYRYSSLHALVPEQAQQDGDEANGEGATKQDANKVSSIRWKSSSWLEEVMFYHVIKLLVEGTAFRDSRTALELIHISSKWMALFTTASNSMTADMLSGGLQDPQVRHEMETAWGALVPLVLRLVDNAAFVKVVSQPSAKGTRKMFSESLASFVQVIQQSPQLPQFQQFINKLELFRTEVLAPLDPVDKSKQAANAVMDDILDSTVGVENLVIPEIPISNTRAGLYIYLSASLVGRPLIDDHAFFSYLNNRYQGDVQQSAVDLILASFDLLANAVFRNEGPRDAQLLRSFLINKVPLILAQLCPPGFSTPSAEFCITQALPHVDTSVFPTASLMFDESRNNNPYTESVREEFCSACALHGLIEREHVERILGESSMSYEPSQEKYSKEKLVQSCLSDPDKIQALIRDMDKMDGNVGAVCQALVELLRQLCHSKETMSLKLLCSQLVQKPQSLDVLLLFEKLPTILEPICQLLDGWRYEEDQGEYQPVYEEFGAILLLVLAFAYRYSLSPADIGIISPDSNVAKIIGRAHISRELDELSEQENGHLGGWIHGLFDSDAGGLGDDLMSSCPPADFYLLIASLFQNIVIAYTQGFLTDDALRSGVEYLIDTFLLPSLIPAIRFLSDYLWVEQKEQKSIIKILQLILLPTSISGEATTMLASVKGIVAKPLEHSLRAYQRQDPKNQDIEPLLRVLKDSLPFSRRTGAAEHQELEMWATSSSSGLSGAAKHLIQGLVQWCVHTDETAMPTSYTHRQVIATLKIVGARRFLRVILEEIRQQTLAGNGSLVYDVATALVCAPNVSNELPPTSGLLDEAGNMLPILQRPLTLREVLKMEAEDYRKLQKKDAELAEIVVRLHRRVEAQMVLPPPPMLQAADMQLDLAGDATNLEDSIVVAAGVQGDGTMSMDGVGSLDMSLGGISSDLGLGGPGSSGGLDASAEADLFGSLDDTDMDVFDGWGGMDLGGP
Length1053
PositionTail
OrganismTrichoderma asperellum CBS 433.97
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma.
Aromaticity0.07
Grand average of hydropathy-0.055
Instability index46.75
Isoelectric point4.93
Molecular weight116309.78
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP20100
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.95|      21|      33|     651|     680|       1
---------------------------------------------------------------------------
  651-  672 (35.98/35.68)	G.LGDDLMSSCPP..ADFYLLiASL
  683-  706 (27.98/ 8.40)	GfLTDDALRSGVEylIDTFLL.PSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      89.59|      29|      33|     969|    1000|       2
---------------------------------------------------------------------------
  969- 1000 (44.38/34.21)	LAGDATNLEdsiVVAAGVQG..DGTMSMDGVGSL
 1004- 1034 (45.21/26.84)	LGGISSDLG...LGGPGSSGglDASAEADLFGSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     131.56|      41|      52|     473|     514|       3
---------------------------------------------------------------------------
  473-  514 (64.51/45.48)	SQEKYSKEKLVQSCLSDPDKIQALIRdMDKMDGNVGAVCQAL
  524-  564 (67.05/42.59)	SKETMSLKLLCSQLVQKPQSLDVLLL.FEKLPTILEPICQLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.52|      15|      20|     790|     804|       4
---------------------------------------------------------------------------
  790-  804 (29.44/15.82)	SRRTGAAEH..QELEMW
  810-  826 (24.08/11.86)	SGLSGAAKHliQGLVQW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      76.08|      22|      33|     118|     139|       5
---------------------------------------------------------------------------
  118-  139 (38.12/27.62)	EGATKQDANKVSSIRWKSSSWL
  153-  174 (37.96/27.47)	EGTAFRDSRTALELIHISSKWM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      95.76|      30|      52|      21|      51|       7
---------------------------------------------------------------------------
   21-   51 (49.48/41.62)	FVSkCLTK..RLDASTFEDYVRLVQSKHRLPPE
   75-  106 (46.29/33.45)	YVS.VLTKlrYTDAVSILRALYRYSSLHALVPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.21|      18|      19|     389|     406|       9
---------------------------------------------------------------------------
  389-  406 (32.57/23.21)	LILAQLCPPGFSTPSAEF
  410-  427 (31.63/22.29)	QALPHVDTSVFPTASLMF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP20100 with Med5 domain of Kingdom Fungi
Unable to open file!