Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MNEIIDGRFERVENALAKLINSISAYNPSPALATDLVTADAELSQGLEQLSTHQTNYSRIVSLRNTSAALDQQIKETLTLLTDTRRALLSTPATTFPEATNPVSYSELLSYARRISKFTLPSTYRELETPGENAEAAGNTPKETKPESQTNGAATPVAASNGVDKDTQMSGTAVDGDTATPSATQSQTQTQSQNTTSTGTSLPEGYTQFLNPLADIPFIPWPTEEHMRRGVLASIQVLLDQNIDPATFDPAKSAELEEERKRVAEEEDRAREEEKARMEEERRIEMERRASVSGNSAAPAREQERPSVFQLETFDDDEESD |
Length | 321 |
Position | Middle |
Organism | Amorphotheca resinae ATCC 22711 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Myxotrichaceae> Amorphotheca. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.748 |
Instability index | 49.15 |
Isoelectric point | 4.52 |
Molecular weight | 35287.16 |
Publications | PubMed=29315638 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP20096 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 83.99| 25| 37| 131| 155| 2 --------------------------------------------------------------------------- 131- 155 (41.99/24.02) GENAEAAGNTPKETKPESQTNGAAT 171- 195 (42.00/24.02) GTAVDGDTATPSATQSQTQTQSQNT --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 81.83| 28| 37| 23| 57| 3 --------------------------------------------------------------------------- 23- 57 (42.89/40.82) ISAYNPSPALatdlvtaDAELSQGLEQ........LSTHQTNY 61- 96 (38.94/23.42) VSLRNTSAAL.......DQQIKETLTLltdtrralLSTPATTF --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EEERRIEMERRASVSGNSAAPAREQERPSVFQLETFDDDEESD 2) IPFIPW | 279 216 | 321 221 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab