<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20093
| Description |
Uncharacterized protein |
| Sequence | MAANYWESTQRKHWQFTRQQLEDFRTKLEDEDRNLVQMYPLPQLRHLSIYFNQQISRLGKRLGVRQQAMATAQLYIRRFYSKVEIRRTNPYLVIATAVYLACKMEECPHHIRLVVSEGRTLWPDFFSSDTSKLGECEFFLISEMSSQMIVHQPYRSLTSLQATFSLTQEEYALAWSIINDHYMTDLPLLFAPHIIAIMAILLALVLRPNTTGIQSASTSANSIASAAQSALSSAGQAKAGSAENKAGGPRTKVQKLVNWLAESNIDIEAIVDCTQEIISFYEVQEQYNEKLTREQINRFVKARGLDK |
| Length | 307 |
| Position | Kinase |
| Organism | Amorphotheca resinae ATCC 22711 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Leotiomycetes incertae sedis> Myxotrichaceae> Amorphotheca.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.264 |
| Instability index | 58.68 |
| Isoelectric point | 8.27 |
| Molecular weight | 35135.76 |
| Publications | PubMed=29315638
|
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20093
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.70| 12| 14| 186| 197| 1
---------------------------------------------------------------------------
186- 197 (20.90/15.53) LPLLFAPHIIAI
202- 213 (19.80/14.36) LALVLRPNTTGI
---------------------------------------------------------------------------
|