Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MPSDLPQTPQSPSYDSTYFPSKLAASPRTGSSLPTPAHSINGSMSSTTPDVVAEAAHVEDPSNKRKRDIEDGGDRDQKKVHLEDSRLRIEDLHLDVGEKYLLCRTPHPPFPIPLKEDLFQRYGLTDLAETVARSNPDGSKKTVRKTYKGHIKRVLKLSGNFDSVKRGAEEPNSLVSMMCQPDEVWNAQYAQASKEIETGIPQPVLANLGKAVTMARGVIPKDMWNSSVLGELVPPSAPAQPAKGVQNGVKTQQPPQAAGVRTVKPEVPRPKRNIKKRTYGDASFEGYGEGFVDDDAQETGYSTGDGDERTGRKRPKKTIQSNSFQGPVARQNSYGPGMVGV |
Length | 341 |
Position | Head |
Organism | Amorphotheca resinae ATCC 22711 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Myxotrichaceae> Amorphotheca. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.806 |
Instability index | 52.18 |
Isoelectric point | 8.96 |
Molecular weight | 37174.26 |
Publications | PubMed=29315638 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP20089 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 198.54| 47| 131| 26| 72| 1 --------------------------------------------------------------------------- 26- 72 (78.28/37.50) SPRTGSSLP.....TPAHSINGSMSSTTPDVVAEAAHVEDPSNKRKRDIEDG 163- 199 (60.64/27.69) SVKRGAEEP........NSLVSMMCQ..PDEVWNAQYA.....QASKEIETG 226- 275 (59.62/27.12) SSVLGELVPpsapaQPAKGVQNGVKTQQPPQAAGVRTVKPEVPRPKRNIK.. --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 117.53| 34| 162| 119| 152| 2 --------------------------------------------------------------------------- 119- 152 (60.41/30.37) FQRYG...LTDLAETVARSNPDGSKKTVRKTYKGHIK 284- 320 (57.12/28.40) FEGYGegfVDDDAQETGYSTGDGDERTGRKRPKKTIQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PKKTIQ 2) SYDSTYFPSKLAA | 315 13 | 320 25 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab