Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDKYIDERFERLERALANLTDSIANYTPQPAAAHELMAADRALADGLQQLQIHQNNYALIVRLRAESDALDAQIRDTLNLLWTTRRDMSSVNITTFPELQHHDVNWEELLSYARRISKTTLPAPSILSAAAAAANGTATGINGEDGGMSTGDAAGTPNTATAAPTPAPGVGTPAAVNGMVKSPAPSAQIAVPLQQVVPSGTALPDDWNRFLDPLTDMTFQPWPTEDKIRSGALAALEELAMQGIDPRGFDPAEEEARRQREEEERRVQEEREAREREDNLRKMREDQARIARERQRERERAQEEALRRGSMGGPTTAAEGLSPTTAQPARKQFQFMGDMDDDDDD |
Length | 345 |
Position | Middle |
Organism | Coniella lustricola |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Diaporthales> Schizoparmaceae> Coniella. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.732 |
Instability index | 58.28 |
Isoelectric point | 4.72 |
Molecular weight | 38024.64 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP20080 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 74.26| 24| 30| 147| 173| 1 --------------------------------------------------------------------------- 147- 173 (41.35/28.00) GMSTGDAagtPNTATAAPTP..AP.GVGTP 178- 204 (32.91/15.29) GMVKSPA...PSAQIAVPLQqvVPsGTALP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 56.89| 18| 31| 253| 270| 2 --------------------------------------------------------------------------- 253- 270 (29.23/13.68) EEEARRQREEEERRVQEE 277- 294 (27.66/12.60) EDNLRKMREDQARIARER --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 33.75| 11| 22| 41| 52| 3 --------------------------------------------------------------------------- 41- 52 (15.02/11.29) RALADGLQQlQI 64- 74 (18.73/ 9.46) RAESDALDA.QI --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 27.14| 8| 30| 211| 221| 4 --------------------------------------------------------------------------- 211- 221 (11.57/12.49) LDPltdMTFQP 244- 251 (15.58/ 7.22) IDP...RGFDP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EALRRG 2) TTAAEGLSPTTAQPARKQFQFMGDMDDDDD | 304 315 | 309 344 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab