<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20076
Description |
Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSSLHPQTPQSPSQNSPSTMDPASTINSTISSFTATLPTPAHSINGSNIPSEANQDVIMGEDTPQKRKRESGDVGEQDREKRVHTDDGIPSIQAIHENVGEKYLLLKQTWKPAQPVLSADLFDLYGLAGLAGEVARVLPDGTKNAMRKTYKGQIKKLGLTGHFDAIKKEPNDPEGFLSLIDCPPQEWEVLFVNGKEIGSGLRPEVQRALPKATTMARGPIGKDKWDSSVLADFAGDRGVRGSSSKATAPGTPLHPASAGVPRLKGQGLGGPDAARPRRVGKKRSYGDNSYEGYGDSFQDEETGAETGYSTGEGEGNRRRKKVLRALTSAYACILVQSHVLTRCRMLSPAWVHPANFLVTPALVC |
Length | 364 |
Position | Head |
Organism | Coniella lustricola |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Diaporthales> Schizoparmaceae> Coniella.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.586 |
Instability index | 43.34 |
Isoelectric point | 8.74 |
Molecular weight | 39149.58 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP20076
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 128.64| 41| 209| 31| 73| 1
---------------------------------------------------------------------------
31- 73 (66.51/48.83) SSFTATLP.TPAHSINgSNIPSEANQDvIMGEDT..PQK..RKRESGD
242- 287 (62.13/36.80) SSSKATAPgTPLHPAS.AGVPRLKGQG.LGGPDAarPRRvgKKRSYGD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.87| 23| 69| 129| 156| 3
---------------------------------------------------------------------------
129- 156 (34.89/34.07) GLAGEVARVLPDGTKNAmrktyKGQIKK
200- 222 (42.97/27.71) GLRPEVQRALPKATTMA.....RGPIGK
---------------------------------------------------------------------------
|