<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20064
| Description |
Uncharacterized protein |
| Sequence | MDRNQQSSSTSLLFREGETIAEILQAYQKLVAIATDRITNKVSVGQAAHNDMAMKLETQRLIKGVENLLALTRRIRELWIVGPIRRPDDGGRQLEETIEADVRSVTEILNQLRSNVRQQSVTAGGGYGQYVVGPLSKPPVLGPAAPIAAPQQPISDAAGSNTSSGSQGNGTA |
| Length | 172 |
| Position | Head |
| Organism | Coniella lustricola |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Diaporthales> Schizoparmaceae> Coniella.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.359 |
| Instability index | 52.06 |
| Isoelectric point | 8.06 |
| Molecular weight | 18417.54 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20064
No repeats found
No repeats found
|