<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20063

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMTSQEFVQDSYDNWKDFLELALRRRLDHAKFASFVPIHAGLYPLTPLPIADLFLRPTRGCRYSLDTRVPFYLQTLLDLRLVDLQAVLAGLLRYTSVRTIVDSAKSGDGGKNANGSLSKPVGGIQDTDKSQEVILWENSYTYDEVIFYRLRKAVATGSAIRHGKDVFEVCLMMAKWMMLFTAASSALPAQHDEDVIMGGIGAAYSATRKMRDQLDNVMAAFVMLLLGIFENPVVLQALNESYTKSVRRALSKSLANFVPALVQGSSQETQGTAQIAAKLEMFRTQTLAGFEPVDKKNQAANEEMNELFDETIGLQNVVLQPLDIARSRAGLYIYLNAALIGRPLLDDASLYSYLHNRFEGDIQSTAIDLILASFDVLASAIFRNEGQRSAHLLRSYLINKVPLILASFAATASPMYPFNSELCITNALSRVDTNTFPTLSSLFESGENNPFTESVRSDFVTACCLHGLVPESSIDKLLGDYAYQTLPAGGRYVKDKLVQECVADHDRMLRLITELEKMEGNAGAVCQAMTEMLSRLCSNKETMTLKQLCSQLARNPLNLDVLLLFDKTHTVLTPVCELLDNWGYEDDQGEYQPVYEEFGSVLLLLLAFVYRYNLSASDLALRSPDSFIAKLLGKGQVSRSLEELSEQERSNLDGWIHGLFDNDGGGLADELLSSCPPQNLYILIPTLFHHIVLAFSTGYLTEESLKTGIEYLVEPFLLPSLVTAIIYLSNCLWTDRSEENKAIIKILQLILKPTQKLSPESSDMLNSVRNIVAKPLENGLRNYQRQNPKSLDVEPLLSVLKDNIELSRRTGAAGVQEVETWSNSSSGGLLANIKHTVHNLTMWSMQQTAMTASYAHRQILLGLKLLGAKRVLYAIFEELKSQTEANSGSALYGYDVAVALVCAPDVTNTVDSAPPVSSLEDAAAQVTRVPPQRRLSLRDALKWEAEGWKKIQKKDPVIAEIVVRLYQKVEKQMAPAAIAMPSLDTAAAIADALVVDDATAAAVMADPMSLDSATVAGLPLDLGAGAGDLGLDTGSGSAGGLDLVGGEDWGLDGLDGWDANMDLS
Length1063
PositionTail
OrganismConiella lustricola
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Diaporthales> Schizoparmaceae> Coniella.
Aromaticity0.07
Grand average of hydropathy-0.017
Instability index44.50
Isoelectric point4.95
Molecular weight116614.91
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP20063
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      77.13|      16|      17|    1027|    1042|       1
---------------------------------------------------------------------------
 1007- 1021 (18.64/ 8.07)	.MSLDSATVAGLPLDL
 1027- 1042 (27.14/15.38)	DLGLDTGSGSAGGLDL
 1047- 1062 (31.35/19.01)	DWGLDGLDGWDANMDL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.43|      16|      32|     366|     381|       2
---------------------------------------------------------------------------
  366-  381 (27.11/14.91)	IDLILASFDVLASAIF
  400-  415 (29.32/16.68)	VPLILASFAATASPMY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.67|      15|      17|     904|     920|       3
---------------------------------------------------------------------------
  906-  920 (26.05/19.64)	TNTVDSAPPVS..SLED
  922-  938 (21.62/ 7.95)	AAQVTRVPPQRrlSLRD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.88|      13|      17|     328|     340|       4
---------------------------------------------------------------------------
  328-  340 (23.02/15.70)	AGLYIYLNAALIG
  347-  359 (24.85/17.58)	ASLYSYLHNRFEG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.78|      18|      24|     500|     517|       5
---------------------------------------------------------------------------
  500-  517 (31.77/22.02)	CVADHDRMLRLITELEKM
  525-  542 (33.01/23.16)	CQAMTEMLSRLCSNKETM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     104.88|      31|     233|     629|     660|       6
---------------------------------------------------------------------------
  629-  659 (55.14/31.12)	KLLGKGQVSRSL.EELSEQERSNLDGWIHGLF
  669-  687 (26.12/15.33)	.............ELLSSCPPQNLYILIPTLF
  863-  885 (23.61/ 7.42)	KLLGAKRVLYAIfEELKSQTEAN.........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     121.20|      39|     146|      57|      97|       7
---------------------------------------------------------------------------
   57-   97 (63.03/46.61)	TRGCRYSLDTRVPFYLQTLLDlrLVDLQAVLAGL.LRYT.SVR
  206-  246 (58.17/36.70)	TRKMRDQLDNVMAAFVMLLLG..IFENPVVLQALnESYTkSVR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP20063 with Med5 domain of Kingdom Fungi
Unable to open file!