<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20058
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MQWVTTLITSIESQFKFASRQNSWNIHHRLLRSHNPPPTKTYDDDDGPSTEPPPPPPTSYQHLLHVSYLSQQRTWCYIHTPPPEQPSNHGPANPDAIISIPQPQIESHFQLLVNTWAPLWQFRSILNIPQGHTFSAGQFTIRFGDIRSARQGTQAAIIPSPGVVVCITTTIGAPENDGSSHNVGRDDSLNGGEAAQDEELDFEEARDVIRALWRSLKTGRDFGKSEPREVFMGKDGFEGKGNLEKQYEAHVRMWCEIMRMRG |
| Length | 262 |
| Position | Head |
| Organism | Corynespora cassiicola Philippines |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Corynesporascaceae> Corynespora.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.674 |
| Instability index | 51.64 |
| Isoelectric point | 5.98 |
| Molecular weight | 29575.67 |
| Publications | PubMed=29551995
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20058
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.82| 9| 26| 52| 62| 1
---------------------------------------------------------------------------
52- 62 (17.43/10.58) PPPPPPTsyQH
81- 89 (19.38/ 6.48) PPPEQPS..NH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 108.44| 30| 91| 11| 42| 2
---------------------------------------------------------------------------
11- 42 (51.88/40.24) IESQFKFASrqNSWNIHHRLLRSHNPPPTKTY
105- 134 (56.56/37.25) IESHFQLLV..NTWAPLWQFRSILNIPQGHTF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.65| 15| 177| 64| 78| 3
---------------------------------------------------------------------------
64- 78 (29.93/24.09) LHVSYLSQQRTWCYI
243- 257 (29.71/23.86) LEKQYEAHVRMWCEI
---------------------------------------------------------------------------
|