<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20056
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSEHSSKRQRLTGSFSPASPPYHASAKTDQTKPIVHPNTPTSPPYLPMNSQSHGAHTTSATAPGPDMTPPSSVHKSSHPHHSASSANNPMPFPTPASTTGVMSSSNLDSDGDALMDDPHDFSHRHSNHNRQSRDDVWSRRGGVAAAEGIFGSQLFKLCEKAPEVSRPHGSQNLIELYGLNKLANSVARNDPVTGEKINKLRKSYEGHIKLMKIAGKPKATKMEGMMTGLMQFPDFEYDMQKVNGKEIQGALTPDKSALSSRFDSLLNGAFAGMAPGPLPPHEASKFKAYMATDETVKAKGPDSMAERSAATTPNPANASAASRISRPERAGSKRQYNDSSFQGYGEGFTDDFGADSTGGEDNPQGNLAKKRRLAFERTSHQVEVGGVRR |
| Length | 389 |
| Position | Head |
| Organism | Corynespora cassiicola Philippines |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Corynesporascaceae> Corynespora.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.837 |
| Instability index | 48.64 |
| Isoelectric point | 9.18 |
| Molecular weight | 41849.96 |
| Publications | PubMed=29551995
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20056
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 97.46| 20| 23| 52| 71| 1
---------------------------------------------------------------------------
26- 45 (29.59/12.34) AKTDQT.KPIVHPNTPTSPPY
52- 71 (36.92/17.25) SHGAHT.TSATAPGPDMTPPS
77- 97 (30.95/13.25) SHPHHSaSSANNPMPFPTPAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 80.74| 18| 23| 260| 277| 2
---------------------------------------------------------------------------
235- 253 (22.89/10.96) FEYDmQKVNGKEIQGALTP
260- 277 (30.31/16.59) SRFD.SLLNGAFAGMAPGP
284- 301 (27.53/14.48) SKFK.AYMATDETVKAKGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.71| 20| 26| 138| 159| 3
---------------------------------------------------------------------------
138- 159 (29.66/20.50) SRRGGVAAAEGIFGsqLFKLCE
165- 184 (34.05/18.16) SRPHGSQNLIELYG..LNKLAN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 95.28| 28| 45| 302| 329| 4
---------------------------------------------------------------------------
302- 329 (46.80/29.82) DSMAERSAATTPNPANASAASRISRPER
350- 377 (48.48/31.17) DDFGADSTGGEDNPQGNLAKKRRLAFER
---------------------------------------------------------------------------
|