Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDAILQAQFQRVEHALTTLVDSIASYNPSPQAAVDLVAADDELSRGLDQLALHQSNHARILALRTEAEALETQVKSSVATLAGLRRELFSLPSSASDADTRPVPFDELLQFAKNISKHTVPPTYREPIPDFPDLNQLQEKGKDAEKDGGGSNGVPSNGVNTPANPNPSEQPKENAEGEAEPKEITEQEAEWLRKLNENQLGWTPWPSNDKIRRGGLMQIQYLLDTGKDPAKIDISKLDDEEKRKMEEGVAQNAEQQAQNEPDVRRESVAVPPPAPRAAEPKEVFAGFGDFEDDED |
Length | 295 |
Position | Middle |
Organism | Corynespora cassiicola Philippines |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Corynesporascaceae> Corynespora. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.805 |
Instability index | 48.89 |
Isoelectric point | 4.54 |
Molecular weight | 32446.34 |
Publications | PubMed=29551995 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP20046 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 160.11| 52| 97| 133| 184| 1 --------------------------------------------------------------------------- 133- 184 (92.00/43.07) DLNQLQ...EKGKDAEK.DGGGSNGVPS....NGVNTPANPNPSEQPK.........ENAEGEAEPKEI 215- 283 (68.11/30.17) GLMQIQyllDTGKDPAKiDISKLDDEEKrkmeEGVAQNAEQQAQNEPDvrresvavpPPAPRAAEPKEV --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EPDVRRESVAVPPPAPRAAEPKEVFAGFGDFEDDED 2) KIRRGGLMQIQYLL | 260 210 | 295 223 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab