<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20045

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMDSLIRTWALFFDRCLENRLSSELFDTAVAQLHSKSPLPGRKLAAVLLKPRSANAVSPDPRVIIYLERLLALKKVDASDVLSSAFQYSNDRPSRTGDDGHSKDDQSRWQNPPELEEIVFHRLHKAFSSGERPVSNAEAARTLAVASGWMSAMVTSHTSDSMIQAMAGIQQQPQQQSINVREALGMLVVGLIENPRILQLLTKEELKDVRKNFAQSLSTFIPFLSQTSIQISNRLEISQKEHDLHDKSVSNINGESGENGGLEVAALQLEAVMDLPTVNTRSGLYIFLNSLLVARPLTDDFMIVNYLHSRYKIDPQIMGTDLVTAAFDILANAMYRSEPSQTMFSLKSFLINKIPLLLGQLSSSMFLTPELCITQALSHVDPNAFPAFSQGFDDIMGNNPSLSDVRQDFLNSCALHGLIPANTIERLLGETPLQGPPETKYVKKDLLSQCKDNFEKVNMLIDELENLDGNAGAIVGALTEFISHLCETQMTMYLKTISNLLSKKIQALDVILQFTSPASILRPLCQFLDEWRYDGDQGEYQPVYDEFGAILLLILAFVHRYDLSYHDLGINHDSFVAQLLERGHRSIATDDLTEEQGRQLGSWLRGLYDSDKEGLSNEVFASCRPQDFYLIVPTLFSQTVMACAAEVLSLDSVKGGLEYLNETFLLPALVGGLTWMATHAMEQTHQDLEVLMQIFHKLVRSAHTSGRGDAQAMHSTILSIVSDRLEKCFRTLKRRHPSRTDIEPLLQAIKGHLNYERSVYTSMTELEQWITAPNNTLYSSLRSTVQQLSQWGSPASLQPNPPSYTHRQVYTSIMILGTSRTLRAIVDEVKAQTDAGNGPAALDIGVSLICAPTVENSAVPVDWVGSLTPAPASPRTCMNLREMLKAEFDNAASLISTDPLAAETIARLHRRVEAQLAVIAQAGLSAAQINLQNVGMVDVQPQDMQDLDKAMNDAAAATMAAANGDMDMNKQALQRSIDDHLDLTGTGGALDLSGMGVGGPGTDDMSTNMDDLNTLDLGDMDMGMGMGDDDDAWGLDFNNM
Length1039
PositionTail
OrganismCorynespora cassiicola Philippines
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Corynesporascaceae> Corynespora.
Aromaticity0.06
Grand average of hydropathy-0.161
Instability index41.21
Isoelectric point4.88
Molecular weight114501.73
Publications
PubMed=29551995

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP20045
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.90|      21|      25|     989|    1012|       1
---------------------------------------------------------------------------
  989- 1009 (41.31/25.91)	LDLSGMGVG.GPGTDDMSTNMD
 1014- 1035 (38.59/16.43)	LDLGDMDMGmGMGDDDDAWGLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.45|      21|      25|     754|     777|       2
---------------------------------------------------------------------------
  757-  777 (38.00/26.43)	SVYTSMTELEQWITA....PNNTLY
  779-  803 (31.45/12.85)	SLRSTVQQLSQWGSPaslqPNPPSY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     100.64|      26|      26|     543|     568|       3
---------------------------------------------------------------------------
  519-  540 (24.00/12.78)	......ILRPLCQFLDewRYDGDQGEYQ
  543-  568 (46.26/31.96)	YDEFGAILLLILAFVH..RYDLSYHDLG
  571-  591 (30.37/18.27)	HDSFVAQLL...ERGH..R.SIATDDL.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.01|      16|      23|     297|     314|       4
---------------------------------------------------------------------------
  297-  314 (25.16/26.59)	TDDFMIVNylHSRYKIDP
  323-  338 (27.84/20.27)	TAAFDILA..NAMYRSEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     100.88|      27|      27|     861|     887|       6
---------------------------------------------------------------------------
  846-  864 (31.59/18.27)	SL.ICAPTVENSAV........PVDWVG
  865-  891 (45.33/29.36)	SL.TPAPASPRTCMNLREMLKAEFDNAA
  892-  915 (23.95/12.10)	SLiSTDPLAAETIARLHRRVEAQL....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.31|      27|      31|     678|     708|       8
---------------------------------------------------------------------------
  678-  708 (36.18/39.89)	HAMEQTHqdLEV....LMQIFHKLVRSaHTSgRGD
  710-  740 (44.13/29.05)	QAMHSTI..LSIvsdrLEKCFRTLKRR.HPS.RTD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.99|      15|      15|     645|     659|      10
---------------------------------------------------------------------------
  645-  659 (24.45/14.46)	EVLSLDSVKGGLEYL
  661-  675 (27.55/17.20)	ETFLLPALVGGLTWM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     148.30|      48|     220|      23|      70|      11
---------------------------------------------------------------------------
   23-   70 (78.62/57.07)	ELFDTAVAQLHSKS.PLPGRKLAAVLLKP.RSANAVSPDPRVIIYLERLL
  242-  291 (69.69/49.62)	DLHDKSVSNINGESgENGGLEVAALQLEAvMDLPTVNTRSGLYIFLNSLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.30|      11|      32|     934|     944|      12
---------------------------------------------------------------------------
  934-  944 (21.10/11.23)	GMVDVQPQDMQ
  963-  973 (20.20/10.48)	GDMDMNKQALQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP20045 with Med5 domain of Kingdom Fungi
Unable to open file!