<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20032
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MAQPALRQEDLKALDQTRQRLIQLTSNIASLKADFQKGAPLPEYSSVMTSSSILTTNIKSMTDHLSAHGDTLSRIVAFPSTNFPGRTQEGLLLQLLRKKLEPQVETWVDEGRNLQIDGLAEEGKDGNLEETWKWAAEWIGPRIRKYALNEAGDEYTAEERESGVENVNTGLRDEEESDEDDEDAEDGDQVMGGTSQSQEKKKASEKAMTRKDGRIRSKDEILRFATSGVAI |
| Length | 231 |
| Position | Head |
| Organism | Rutstroemia sp. NJR-2017a WRK4 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Rutstroemiaceae> Rutstroemia> unclassified Rutstroemia.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.820 |
| Instability index | 44.98 |
| Isoelectric point | 4.73 |
| Molecular weight | 25756.20 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20032
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.27| 20| 22| 149| 170| 1
---------------------------------------------------------------------------
149- 170 (25.61/27.16) NEAGDEyTAEERESGvENVNTG
174- 193 (35.66/24.59) EEESDE.DDEDAEDG.DQVMGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.45| 17| 28| 25| 52| 3
---------------------------------------------------------------------------
25- 41 (28.59/34.47) TSNIASLKADFQ.KGAPL
55- 72 (25.86/ 8.36) TTNIKSMTDHLSaHGDTL
---------------------------------------------------------------------------
|