<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20022
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MSDSALQDVLMKSDQSPPPVPDDSNEPKFGGFTRFEIELEFVNGLSSPLYLNHLASLNSGTLLSSPAFVAYLAYLQYFTQPPYLKYLTYPGPSLKHLELLQNETFRRDCLSLEVVGMLQSEDYAAVERWNKE |
| Length | 132 |
| Position | Middle |
| Organism | Rutstroemia sp. NJR-2017a BBW |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Rutstroemiaceae> Rutstroemia> unclassified Rutstroemia.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.283 |
| Instability index | 79.95 |
| Isoelectric point | 4.62 |
| Molecular weight | 14942.69 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20022
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 68.68| 14| 15| 45| 58| 1
---------------------------------------------------------------------------
45- 58 (24.68/11.81) LSSP.LYLNHLASLN
63- 76 (24.05/11.36) LSSP.AFVAYLAYLQ
87- 101 (19.96/ 8.48) LTYPgPSLKHLELLQ
---------------------------------------------------------------------------
|