Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MSDSALQDVLMKSDQSPPPVPDDSNEPKFGGFTRFEIELEFVNGLSSPLYLNHLASLNSGTLLSSPAFVAYLAYLQYFTQPPYLKYLTYPGPSLKHLELLQNETFRRDCLSLEVVGMLQSEDYAAVERWNKE |
Length | 132 |
Position | Middle |
Organism | Rutstroemia sp. NJR-2017a BBW |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Rutstroemiaceae> Rutstroemia> unclassified Rutstroemia. |
Aromaticity | 0.12 |
Grand average of hydropathy | -0.283 |
Instability index | 79.95 |
Isoelectric point | 4.62 |
Molecular weight | 14942.69 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP20022 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 68.68| 14| 15| 45| 58| 1 --------------------------------------------------------------------------- 45- 58 (24.68/11.81) LSSP.LYLNHLASLN 63- 76 (24.05/11.36) LSSP.AFVAYLAYLQ 87- 101 (19.96/ 8.48) LTYPgPSLKHLELLQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GFTRFE 2) PYLKYLTY | 31 82 | 36 89 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab