<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20017
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MATHQDPPLDEIQWRDPNWLAAHGGVHDNSILHYFAESPFYDRTSNNGILTSQALFNPNMFYLLATRAAFEGRLKTMSGLEFIVAQEPAEMAPGTGTGVWVIRKQTRRKRAPEDDEIIVHSSYFVVGENIYMAPAVSDVLGSRMLAILTSLTNAISKVSELPNFSPSLGHTYLPPVPPRTKAITSGNTQISKENTPMPDGLSTDTKKSAASASNNILGHHLLEDSLNITLKYGDEYMDENPITGYPGDFHLSTTGRKEKEKLMVPPTTKPAGFGLAGKAAAPTPLKTDIAIQKKAKNGEKSPRTPGTGKPKRRKSKSALSGGVSPT |
Length | 326 |
Position | Head |
Organism | Rutstroemia sp. NJR-2017a WRK4 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Rutstroemiaceae> Rutstroemia> unclassified Rutstroemia.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.477 |
Instability index | 46.31 |
Isoelectric point | 9.15 |
Molecular weight | 35352.69 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP20017
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 117.30| 27| 86| 176| 204| 1
---------------------------------------------------------------------------
176- 204 (44.67/30.47) VPPRTKAitSGNTQISKENTPMPDGLSTD
264- 288 (43.47/23.79) VPPTTKP..AGFGLAGKAAAPTP..LKTD
301- 324 (29.17/13.56) .SPRTPG..TGKPKRRKSKSALSGGVS..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.89| 12| 26| 134| 145| 3
---------------------------------------------------------------------------
134- 145 (21.07/12.39) PAVSDVLGSRML
162- 173 (23.81/14.84) PNFSPSLGHTYL
---------------------------------------------------------------------------
|