<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20016
| Description |
Mediator of RNA polymerase II transcription subunit 13 |
| Sequence | MTASYCLGRKGEPLTLPFSHVANEIWETTLDVISSKKVHWRIVIVKSGAMDQSEIDFWTGLASTESNAQISLTLLTVQTDPSLHIIPPPLKLTPTSATTAQTVITPVSTPQASQSSLFSPDTPSREQPTATAATPVEAPLTEPDNNSRLVDYTDQTWGAILSHRLNNSNSLLEFNPALISGYLVKNGGTTAEDPPVILEGLGYAG |
| Length | 205 |
| Position | Kinase |
| Organism | Rutstroemia sp. NJR-2017a BBW |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Rutstroemiaceae> Rutstroemia> unclassified Rutstroemia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.151 |
| Instability index | 38.48 |
| Isoelectric point | 4.75 |
| Molecular weight | 21969.41 |
| Publications | |
Function
| Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20016
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 112.18| 28| 30| 82| 110| 1
---------------------------------------------------------------------------
61- 81 (24.86/ 9.23) ........LASTESNAQISLTLLTVQTDP
82- 110 (43.84/25.19) SlHIIPPPLKLTPTSATTAQTVITPVSTP
115- 139 (43.48/21.23) S.SLFSPD...TPSREQPTATAATPVEAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.82| 18| 18| 159| 176| 2
---------------------------------------------------------------------------
159- 176 (31.03/21.53) AILSHRL.NNSNSLLEFNP
177- 195 (25.79/16.83) ALISGYLvKNGGTTAEDPP
---------------------------------------------------------------------------
|