Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MAPVNNADHNAVEHSIKNVIQDLYEILVQISSYDISGRPSRDILEGSILRLSSSLQSVHRLTQDENRLPIIPPELIQYVDNGRNPDIYTREFVELARKGNQTMKGKMEAFASFRDILAGEMERAMPELGEDIKGVLEATGGKTDAGKEGGGGNKK |
Length | 155 |
Position | Middle |
Organism | Rutstroemia sp. NJR-2017a BBW |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Rutstroemiaceae> Rutstroemia> unclassified Rutstroemia. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.539 |
Instability index | 41.70 |
Isoelectric point | 5.26 |
Molecular weight | 17094.07 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP20007 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 80.43| 24| 26| 86| 109| 1 --------------------------------------------------------------------------- 86- 109 (40.80/27.45) DIYTREFVELARKGNQTMKGKMEA 115- 138 (39.63/26.48) DILAGEMERAMPELGEDIKGVLEA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IIPPELIQYV 2) IYTREFVELARK | 70 87 | 79 98 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab