| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MAPVNNADHNAVEHSIKNVIQDLYEILVQISSYDISGRPSRDILEGSILRLSSSLQSVHRLTQDENRLPIIPPELIQYVDNGRNPDIYTREFVELARKGNQTMKGKMEAFASFRDILAGEMERAMPELGEDIKGVLEATGGKTDAGKEGGGGNKK |
| Length | 155 |
| Position | Middle |
| Organism | Rutstroemia sp. NJR-2017a BBW |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Rutstroemiaceae> Rutstroemia> unclassified Rutstroemia. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.539 |
| Instability index | 41.70 |
| Isoelectric point | 5.26 |
| Molecular weight | 17094.07 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP20007
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.43| 24| 26| 86| 109| 1
---------------------------------------------------------------------------
86- 109 (40.80/27.45) DIYTREFVELARKGNQTMKGKMEA
115- 138 (39.63/26.48) DILAGEMERAMPELGEDIKGVLEA
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) IIPPELIQYV 2) IYTREFVELARK | 70 87 | 79 98 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab