<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20006
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MPFDLPQTPQSPSYTPSATDSSSKATVSPRINTSLPTPAHSINGSMSSLNSAVEVSQPDDLSNKRKRDVEDHGDRDQKKVHVEDSRLSINDLHQEVGQKYLLCRTQHPPLNTSVSQDLFDRFALNDIAASVARLLPDGKKNVIRKTYKGYIKSLGISGQFDAVRQEWEEDGSLFSLVNPEGPNPTKEIWEANHVRGQEIDKGLSDTVRSSLGRAMTMARGTIPKERWNSSVLGELGAANVDPSKQAATKAKAPIMQGATSIPKANKAAAAAGAGAGAADIARPKRSVKKRTYGDASYEGYGEGYIDDDAGYSTGDGDDRAGGRKRPKKVGSLLYLLNIRANKQKTPTHSFQGPMRQSYGPGMVGA |
| Length | 365 |
| Position | Head |
| Organism | Rutstroemia sp. NJR-2017a WRK4 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Rutstroemiaceae> Rutstroemia> unclassified Rutstroemia.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.733 |
| Instability index | 39.43 |
| Isoelectric point | 9.30 |
| Molecular weight | 39349.44 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20006
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.18| 17| 19| 245| 263| 1
---------------------------------------------------------------------------
245- 263 (23.96/19.25) QAATKAKAPimQGATSIPK
266- 282 (27.23/14.95) KAAAAAGAG..AGAADIAR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.60| 20| 21| 195| 214| 5
---------------------------------------------------------------------------
195- 214 (32.82/21.49) RGQEIDKGLSDTVRSSLGRA
219- 238 (34.78/23.18) RGTIPKERWNSSVLGELGAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.72| 16| 306| 30| 46| 6
---------------------------------------------------------------------------
30- 46 (26.66/19.28) RINTSlPTPAHSINGSM
339- 354 (32.07/18.88) RANKQ.KTPTHSFQGPM
---------------------------------------------------------------------------
|