<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20004
| Description |
Mediator of RNA polymerase II transcription subunit 17 |
| Sequence | MSSPNGLSNGLPISLRPAPKPTNNAIPLPLLISRINAERGSFRNLSEDSLRQEIAEAEAGGNKEEDESSSDGEDEEEEKEEPDRMKELLTAREEILGQIEHAHNSAMIALDFVSLLLSKDAPVQASTSMSPALREAAGMGTLGADKTQASRVTDQQKQENKKVAKGWKASNLNKTVDSILASATRLEKEIDAETKYWEQVLAVSESGWAVCRMPQEKHTLGVRFGFAEAAPAFRNRSLAALRRNPDGSIYLDQGIISKEPQYLRVRIETNGITTGETILPKAVPEDAPIQDLIFQARNTIFAAELWQELHRESRNLASYGVESHSTNDTITCPLSPTKYIVLDLQPLPNDPFRPVLGKRPDSYLATAVHLMLHLLLSLAHRQNHRKRTAPPPPISHTQRPNQAYHLLRSVITRLSHESSISSLHSLLAPLCSTLASSTHPYPLSYTITPSSTPQFPHLPTPERILTSLVDRLESITVLHFPIPISSSNSEPETNTTLTIQSLTSLLPFSKPTFRLSLTPPTSPLVGICPPPQLLGEWSQVKEYVFWSVGCWLGVRFAEEREGGWMRTTQGNVLRREVGEGVKQVGFEVGEVEGEDGGGIRIKVRWEWMRGVEGEVGAGNGKGLGRGEGEREWVVGGSGSKEPNGVGKGFEMIRQVLEEAGRL |
| Length | 662 |
| Position | Head |
| Organism | Rutstroemia sp. NJR-2017a WRK4 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Rutstroemiaceae> Rutstroemia> unclassified Rutstroemia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.433 |
| Instability index | 48.77 |
| Isoelectric point | 5.84 |
| Molecular weight | 72817.42 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20004
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.52| 29| 35| 434| 468| 1
---------------------------------------------------------------------------
434- 468 (45.88/37.36) LASST..H.PYPLSytitpSSTPQfPHLPTPERI..LTSL
472- 505 (38.64/18.09) LESITvlHfPIPIS.....SSNSE.PETNTTLTIqsLTSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 145.18| 37| 42| 561| 601| 2
---------------------------------------------------------------------------
535- 556 (33.32/14.75) .GEW..........SQVKEYVfWSVGCWLG..........VRF
561- 601 (65.51/43.32) EGGWMRTTQGnvlrREVGEGV.KQVGFEVGEVEGEDGG.GIRI
606- 638 (46.36/23.10) E..WMRGVEG.....EVGAGNgKGLGRGEGEREWVVGGsG...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.79| 12| 136| 376| 393| 4
---------------------------------------------------------------------------
376- 393 (18.25/18.40) LSLAhrqnhrKRTAP.....PPP
515- 531 (20.54/ 7.21) LSLT......PPTSPlvgicPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 144.10| 48| 82| 30| 79| 5
---------------------------------------------------------------------------
30- 79 (67.18/48.25) LLISRiNAERGSFRNLSeDSLRQEIAEAEAGGNKEEDESSSDGEDEEEEK
115- 162 (76.91/46.62) LLLSK.DAPVQASTSMS.PALREAAGMGTLGADKTQASRVTDQQKQENKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.23| 15| 182| 172| 186| 6
---------------------------------------------------------------------------
172- 186 (24.86/16.13) LNKTVDSILASATRL
356- 370 (27.36/18.45) LGKRPDSYLATAVHL
---------------------------------------------------------------------------
|