<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20000
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MREYLLYSQIPAAREEQVLSILAAISSNQPTPINEQILLYAQLKAQEAAVSKRQPQPKTTVTQPLSYHRLVRGFNVDGDTATDVQPWTFRAESVPDTGITTYISRNTTSQLATPEQLSLFKQPQSYHLKRQYVQSGFRFVHHNLIIKVIRFYSNPPETATPPQDPLAETSPPRTPSQLKLIDASGSLIIEVSICVEDPTNSSLTEAALAELMRFKSTLDGAIDLIAPDRLLLDTRVKGNPMGIASGA |
Length | 247 |
Position | Head |
Organism | Cercospora berteroae |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Cercospora.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.288 |
Instability index | 40.53 |
Isoelectric point | 6.43 |
Molecular weight | 27327.73 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP20000
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 178.74| 54| 60| 63| 119| 1
---------------------------------------------------------------------------
63- 119 (83.99/48.98) QPLSYHrLVR.....GFNVDGDTATdVQPWTFRAESvPDTGITTYISRNTTSQLATPEQLSL
122- 180 (94.75/44.81) QPQSYH.LKRqyvqsGFRFVHHNLI.IKVIRFYSNP.PETATPPQDPLAETSPPRTPSQLKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.68| 10| 24| 23| 32| 2
---------------------------------------------------------------------------
23- 32 (19.31/11.23) AAISSNQPTP
48- 57 (19.37/11.29) AAVSKRQPQP
---------------------------------------------------------------------------
|